PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os11g47890.1
Common NameLOC107279284, OsJ_34871
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GRAS
Protein Properties Length: 639aa    MW: 71485.9 Da    PI: 5.1653
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os11g47890.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS339.84.9e-1042586332373
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                        +lL++cA+av++gd + a++lL+++++++s +gd++qR+a +f+e+L+arla+++s++y++l +++ts   +++ l+a+klf  ++ i k+s
  LOC_Os11g47890.1 258 HTLLIHCAQAVATGDWRSATELLKQIKQNSSARGDATQRMACCFAEGLEARLAGTGSQMYQSLVAKRTS---TVDFLKAYKLFTAACCIKKVS 347
                       679************************************************************999999...8******************** PP

              GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakr 185
                        +  N++I++av+g +++Hi+D+++s+G+QWpaL+  L +R++gpp++R+Tg++ p++g   ++++eetg+rL+  A+++gvpf+f++ +a +
  LOC_Os11g47890.1 348 VIFSNKTIYNAVAGRRKLHIVDYGLSYGFQWPALFFLLGAREGGPPEVRMTGIDVPQPGfrPADQIEETGRRLSICARQFGVPFKFRA-IAAK 439
                       **********************************************************9*****************************.799* PP

              GRAS 186 ledleleeLrvkp....gEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsle 272
                       +e+++ e+L+++p    +E+l+Vn+ + l +l desv ++s  +rd vL+ +++++P+v+v +  +  ++++ F++rf eal +ysa fd+l+
  LOC_Os11g47890.1 440 WETVRREDLHLDPeeeeEEVLVVNCLHGLNTLQDESVVVDSpsPRDVVLDNIRDMRPHVFVQCVVNGAYGAPFFVTRFREALFFYSAHFDMLD 532
                       ************9999999*****************98888779************************************************* PP

              GRAS 273 aklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdr 365
                       a++pr++++r  +Er +lgr + nv+acega+r+ r et+++W+ r ++aG++++pl+ ++++ ++  ++  + + + ++ ++++l++gWk+r
  LOC_Os11g47890.1 533 ATIPRDNDDRLLIERDMLGRCALNVIACEGADRVDRPETYKQWQVRNHRAGLRQLPLEAEVVELVRGKVKSLYHKDFVIDVDHNWLLQGWKGR 625
                       *************************************************************************888***************** PP

              GRAS 366 pLvsvSaW 373
                        L+++S W
  LOC_Os11g47890.1 626 ILYAMSTW 633
                       ******** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098558.883231614IPR005202Transcription factor GRAS
PfamPF035141.7E-101258633IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 639 aa     Download sequence    Send to blast
MAAAPKPEEL VVAIEQPFSP SLFLDLPPTP HHDDDPNNVN DDLLLPFISR ILMEDDIDDK  60
FFYQFPDHPA LLQAQQSYAQ ILHAPATSSS SDDTTINNNT TNSTSVPDTL AMPDHDADTQ  120
SAPDDMEMLY MAFLKGREEA TKFLPTNNTL FSGFKAEPVL DIQPTFTFGP SGGGRGRKNR  180
HAEEDDLETE TSRSSKLMAP EHDDAAAADE IFDEIILNGY QMIIKGIDEL RVAMGSQSQA  240
DKNGRRASRA KTAVVDLHTL LIHCAQAVAT GDWRSATELL KQIKQNSSAR GDATQRMACC  300
FAEGLEARLA GTGSQMYQSL VAKRTSTVDF LKAYKLFTAA CCIKKVSVIF SNKTIYNAVA  360
GRRKLHIVDY GLSYGFQWPA LFFLLGAREG GPPEVRMTGI DVPQPGFRPA DQIEETGRRL  420
SICARQFGVP FKFRAIAAKW ETVRREDLHL DPEEEEEEVL VVNCLHGLNT LQDESVVVDS  480
PSPRDVVLDN IRDMRPHVFV QCVVNGAYGA PFFVTRFREA LFFYSAHFDM LDATIPRDND  540
DRLLIERDML GRCALNVIAC EGADRVDRPE TYKQWQVRNH RAGLRQLPLE AEVVELVRGK  600
VKSLYHKDFV IDVDHNWLLQ GWKGRILYAM STWVAHHP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-372616338374GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.878320.0callus| leaf| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329874080.0
Expression AtlasQ53MB5-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os11g47890.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs11g47890
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1370640.0AC137064.4 Oryza sativa Japonica Group cultivar Nipponbare chromosome 11 clone OSJNBb0003C04 map S10003, complete sequence.
GenBankAP0149670.0AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015615829.10.0PREDICTED: scarecrow-like protein 9
TrEMBLQ53MB50.0Q53MB5_ORYSJ; GRAS family transcription factor containing protein, expressed
STRINGLOC_Os11g47890.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP26615129
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-137GRAS family protein
Publications ? help Back to Top
  1. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]