PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os11g47870.1
Common NameLOC4351217, Os11g0705200, OsJ_34870, OSNPB_110705200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GRAS
Protein Properties Length: 693aa    MW: 77442.3 Da    PI: 4.7832
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os11g47870.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS350.13.6e-1073046822373
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                        +lL++cA+av+++d + a++lL+++++++s +gd++qRla +f+e+L+arla+++s++yk+l ++ ts   +++ l+a+klf  ++ i k+s
  LOC_Os11g47870.1 304 HTLLIHCAQAVATSDRRSATELLKQIKQNSSARGDATQRLACCFAEGLEARLAGTGSQVYKSLVAKCTS---TVDFLKAYKLFAAACCIKKVS 393
                       679**************************************************************9999...8******************** PP

              GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakr 185
                       ++  N++Il+av+g++++Hi+D+++s+G+QWp L++ L++R++gpp++RiTg++ p++g   ++++eetg+rL++ A+++gvpf+f++ +a +
  LOC_Os11g47870.1 394 FIFSNKTILDAVAGKRKLHIVDYGLSYGFQWPGLFKCLSEREGGPPEVRITGIDFPQPGfrPADQIEETGRRLSNCARQFGVPFRFQA-IAAK 485
                       **********************************************************9*****************************.799* PP

              GRAS 186 ledleleeLrvkp.......gEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfd 269
                       +e+++ e+L++++       +E+l+Vn+ + l  l desv ++s  +rd vL+ +++++P+v+v +  +  ++++ Fl+rf e+l +ys+ fd
  LOC_Os11g47870.1 486 WETVRREDLHLDReeeeeeeEEVLVVNCLHFLNALQDESVVVDSpsPRDMVLNNIRDMRPHVFVQCVVNGAYGAPFFLTRFRETLFFYSSQFD 578
                       *********9999999999999*****************98888779********************************************** PP

              GRAS 270 sleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgW 362
                       +l+a++pr+++er  +Er +lgr++ nv+acega+r+ r et+++W  r ++aG++++pl+ ++++ ++  ++k + + + ++ ++++l++gW
  LOC_Os11g47870.1 579 MLDATIPRDNDERLLIERDILGRWALNVIACEGADRVDRPETYKQWLVRNHRAGLTQLPLQPQVVELVRDKVKKLYHKDFVIDVDHNWLLQGW 671
                       ****************************************************************************888************** PP

              GRAS 363 kdrpLvsvSaW 373
                       k+r L+++S W
  LOC_Os11g47870.1 672 KGRILYAMSTW 682
                       *********** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098559.806277663IPR005202Transcription factor GRAS
PfamPF035141.3E-104304682IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
Sequence ? help Back to Top
Protein Sequence    Length: 693 aa     Download sequence    Send to blast
MAAAAPQLEE LVDLEPFSPS LFLDLPPTPH SDDPNDDDLI LPFISRMLME DDIDDKFFYQ  60
FPDHPALLHA QQPYAQILDA PSDDTTTNSS DDSASATTNN TTNSAAAANA SWPYDPIELS  120
QLLQSPPHPV SDNHDADVGD TRSAPEDDKD LKLLFSAADN MEMLNMAFLK GREEANKLVP  180
TNNTLFAGFD GASLLKTEPA VDEPTLMFGR SGGSGRGRKN RHGEEDDLEA ETGRSSKLMV  240
PPQEATAAAS EMFDEIMFNW YEVIMKGMEE LRVAMDSEAE KKARNGGGAG RRAARAKAAV  300
VDLHTLLIHC AQAVATSDRR SATELLKQIK QNSSARGDAT QRLACCFAEG LEARLAGTGS  360
QVYKSLVAKC TSTVDFLKAY KLFAAACCIK KVSFIFSNKT ILDAVAGKRK LHIVDYGLSY  420
GFQWPGLFKC LSEREGGPPE VRITGIDFPQ PGFRPADQIE ETGRRLSNCA RQFGVPFRFQ  480
AIAAKWETVR REDLHLDREE EEEEEEEVLV VNCLHFLNAL QDESVVVDSP SPRDMVLNNI  540
RDMRPHVFVQ CVVNGAYGAP FFLTRFRETL FFYSSQFDML DATIPRDNDE RLLIERDILG  600
RWALNVIACE GADRVDRPET YKQWLVRNHR AGLTQLPLQP QVVELVRDKV KKLYHKDFVI  660
DVDHNWLLQG WKGRILYAMS TWVADRDHKS LF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-363076828374GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.878320.0callus| leaf| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329874080.0
Expression AtlasQ53MB0-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os11g47870.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs11g47870
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1370640.0AC137064.4 Oryza sativa Japonica Group cultivar Nipponbare chromosome 11 clone OSJNBb0003C04 map S10003, complete sequence.
GenBankAP0149670.0AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015617900.10.0PREDICTED: scarecrow-like protein 9
TrEMBLQ53MB00.0Q53MB0_ORYSJ; GRAS family transcription factor containing protein, expressed
STRINGLOC_Os11g47870.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP26615129
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-138GRAS family protein
Publications ? help Back to Top
  1. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]