PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os11g47460.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB_related
Protein Properties Length: 173aa    MW: 19530.2 Da    PI: 6.9103
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os11g47460.4genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.32.6e-16243548
                      -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      ++ E+ l++++++++G++ W++Iar+++ gRt++++k++w++++
  LOC_Os11g47460.4  2 SPKEEHLIIELHARWGNR-WSRIARRLP-GRTDNEIKNYWRTHM 43
                      899***************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd001672.83E-11143No hitNo description
SMARTSM007179.7E-10145IPR001005SANT/Myb domain
PROSITE profilePS5129424.29147IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.4E-20244IPR009057Homeodomain-like
SuperFamilySSF466891.25E-12247IPR009057Homeodomain-like
PfamPF002497.3E-15242IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
MSPKEEHLII ELHARWGNRW SRIARRLPGR TDNEIKNYWR THMRKKAQER RGDMSPSSSS  60
SSLVYQSCLL DTVPIISMDG GDIHDDRSCM ARVLKSTQSV MDGYTMDQIW KEIEAPGAPS  120
LLGIDEGKDK ACSNLPCPLL TSTMSDYSCP EVFWKIDNEE TRMLATQSGY GK*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.101740.0leaf| panicle| root| stem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasF4MGF7
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00600PBMTransfer from AT5G59780Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os11g47460.4
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs11g47460
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0752600.0DQ075260.1 Oryza sativa (japonica cultivar-group) MYB transcription factor MYBAS1-3 mRNA, complete cds, alternatively spliced.
GenBankDQ0752590.0DQ075259.1 Oryza sativa (japonica cultivar-group) MYB transcription factor MYBAS1-2 mRNA, complete cds, alternatively spliced.
GenBankDQ0752580.0DQ075258.1 Oryza sativa (japonica cultivar-group) MYB transcription factor MYBAS1-1 mRNA, complete cds, alternatively spliced.
GenBankAK1116260.0AK111626.1 Oryza sativa Japonica Group cDNA clone:J013113N19, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015617959.11e-125PREDICTED: myb-related protein MYBAS1
SwissprotQ53NK61e-127MYBA1_ORYSJ; Myb-related protein MYBAS1
TrEMBLF4MGF71e-127F4MGF7_ORYSJ; Myb family transcription factor, putative, expressed
STRINGLOC_Os11g47460.11e-125(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59780.14e-33myb domain protein 59
Publications ? help Back to Top
  1. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]