PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os11g47460.1
Common NameLOC4351184, MYBAS1, Os11g0700500, OsJ_34832
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 238aa    MW: 27226.1 Da    PI: 8.6705
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os11g47460.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.33.1e-171057148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT++Ed++lv+ v+++G ++W+ +a+  g++Rt+k+c++rw +yl
  LOC_Os11g47460.1 10 KGPWTEQEDLQLVCTVRLFGDRRWDFVAKVSGLNRTGKSCRLRWVNYL 57
                      79********************************************97 PP

2Myb_DNA-binding53.65.2e-1764108248
                       SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       gr+++ E+ l++++++++G++ W++Iar+++ gRt++++k++w++++
  LOC_Os11g47460.1  64 GRMSPKEEHLIIELHARWGNR-WSRIARRLP-GRTDNEIKNYWRTHM 108
                       89*******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.263557IPR017930Myb domain
SuperFamilySSF466891.57E-288104IPR009057Homeodomain-like
SMARTSM007171.4E-14959IPR001005SANT/Myb domain
PfamPF002493.8E-161057IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.7E-191164IPR009057Homeodomain-like
CDDcd001671.16E-101257No hitNo description
PROSITE profilePS5129425.58158112IPR017930Myb domain
SMARTSM007171.7E-1462110IPR001005SANT/Myb domain
PfamPF002492.0E-1564107IPR001005SANT/Myb domain
CDDcd001671.21E-1065108No hitNo description
Gene3DG3DSA:1.10.10.601.6E-2365111IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MVTVREEMRK GPWTEQEDLQ LVCTVRLFGD RRWDFVAKVS GLNRTGKSCR LRWVNYLHPG  60
LKHGRMSPKE EHLIIELHAR WGNRWSRIAR RLPGRTDNEI KNYWRTHMRK KAQERRGDMS  120
PSSSSSSLVY QSCLLDTVPI ISMDGGDIHD DRSCMARVLK STQSVMDGYT MDQIWKEIEA  180
PGAPSLLGID EGKDKACSNL PCPLLTSTMS DYSCPEVFWK IDNEETRMLA TQSGYGK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A4e-2771121105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.101740.0leaf| panicle| root| stem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ53NK6
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. {ECO:0000305}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00600PBMTransfer from AT5G59780Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os11g47460.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs11g47460
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0752600.0DQ075260.1 Oryza sativa (japonica cultivar-group) MYB transcription factor MYBAS1-3 mRNA, complete cds, alternatively spliced.
GenBankAK1116260.0AK111626.1 Oryza sativa Japonica Group cDNA clone:J013113N19, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015617959.11e-178PREDICTED: myb-related protein MYBAS1
SwissprotQ53NK61e-180MYBA1_ORYSJ; Myb-related protein MYBAS1
TrEMBLA0A0E0RC891e-178A0A0E0RC89_ORYRU; Uncharacterized protein
STRINGLOC_Os11g47460.11e-177(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP63637169
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59780.34e-75myb domain protein 59
Publications ? help Back to Top
  1. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]
  2. Li J, et al.
    A subgroup of MYB transcription factor genes undergoes highly conserved alternative splicing in Arabidopsis and rice.
    J. Exp. Bot., 2006. 57(6): p. 1263-73
    [PMID:16531467]