PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os11g45950.1
Common NameOs11g0686700, OsJ_34775, OSNPB_110686700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NAC
Protein Properties Length: 137aa    MW: 15533.5 Da    PI: 9.4699
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os11g45950.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM56.78.2e-1867555127
               NAM  55 ekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyr 127
                        + w++F ++++     +r  r+t sgyWk+ gk   v+s++++ vglkk++ fy+g +p+g+kt+W ++e+ 
  LOC_Os11g45950.1   6 GEPWFYFRHHERWM---HRMDRSTPSGYWKTAGKASFVYSADRHPVGLKKSMLFYRGPEPSGRKTKWKIDEFW 75 
                       45799999888865...69****************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100522.0091114IPR003441NAC domain
SuperFamilySSF1019413.27E-18686IPR003441NAC domain
PfamPF023651.1E-7774IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 137 aa     Download sequence    Send to blast
MGAGAGEPWF YFRHHERWMH RMDRSTPSGY WKTAGKASFV YSADRHPVGL KKSMLFYRGP  60
EPSGRKTKWK IDEFWALDNA ANGSGELLAQ LCRSRQNVGL MPRFPLSLCR LYSTKSSSER  120
HVLATSSDEI SEDESD*
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ2QZH7
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os11g45950.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs11g45950
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1356441e-169AC135644.2 Oryza sativa (japonica cultivar-group) chromosome 11 BAC clone OSJNBa0085H07, complete sequence.
GenBankAP0149671e-169AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015615335.11e-91PREDICTED: putative disease resistance RPP13-like protein 2 isoform X1
RefseqXP_015615336.11e-91PREDICTED: putative disease resistance RPP13-like protein 2 isoform X1
TrEMBLQ2QZH78e-99Q2QZH7_ORYSJ; NAC-domain containing protein 90, putative, expressed
STRINGLOC_Os11g45950.12e-98(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2689955
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22380.12e-21NAC domain containing protein 90
Publications ? help Back to Top
  1. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]