PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os11g45920.1
Common NameWRKY63
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family WRKY
Protein Properties Length: 400aa    MW: 44808.2 Da    PI: 8.9464
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os11g45920.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY70.23e-221071259
                      --SS-EEEEEEE--TT-SS-EEEEEE-ST....T---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY  2 dDgynWrKYGqKevkgsefprsYYrCtsa....gCpvkkkversaedpkvveitYegeHnhe 59
                      dDg +W KY qKe+ g++fpr+Y+rCt+     gC+++k+v+r++ dp +++i+Y+geH+++
  LOC_Os11g45920.1 10 DDGLSWSKYEQKEILGAKFPRAYFRCTHWntkkGCMATKEVQRDDGDPLMFDIVYHGEHTCT 71
                      8**************************9767779**************************97 PP

2WRKY77.91.1e-24109165259
                       --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       dDgy+WrKYGqK+v g  + r+YYrC+++gC++ k+v+r + d+ ++++tY geH++ 
  LOC_Os11g45920.1 109 DDGYSWRKYGQKNVLGFSYLRGYYRCATKGCQASKQVQRHD-DGLLFDVTYFGEHTCA 165
                       8***************************************9.*************995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1182908.24E-21372IPR003657WRKY domain
PROSITE profilePS5081118.946468IPR003657WRKY domain
Gene3DG3DSA:2.20.25.806.7E-22472IPR003657WRKY domain
SMARTSM007741.3E-31972IPR003657WRKY domain
PfamPF031067.4E-221070IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.3E-2594165IPR003657WRKY domain
SuperFamilySSF1182903.92E-23102165IPR003657WRKY domain
SMARTSM007747.3E-34108166IPR003657WRKY domain
PfamPF031062.0E-23109164IPR003657WRKY domain
PROSITE profilePS5081118.326109162IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 400 aa     Download sequence    Send to blast
MWHVRSNTED DGLSWSKYEQ KEILGAKFPR AYFRCTHWNT KKGCMATKEV QRDDGDPLMF  60
DIVYHGEHTC TQTAESNVDE QIRLTRTRDK KVKRTKRKRQ VRVTSVPADD GYSWRKYGQK  120
NVLGFSYLRG YYRCATKGCQ ASKQVQRHDD GLLFDVTYFG EHTCADQPQA AHSSDQSTIL  180
ERPTFKTRLQ GQVDAMEKQH EGFRKMLSSI QEAIGAMSVK QGEVQETMNK MEKSISSWRP  240
QVDAAVQSLQ RDMELQRNQV GAVERHQAEA DKSSNTSQAL EEREEIARRT SQLPTSPTMS  300
LPVSQALEER EEIARRAPLL PTPPTASMPA STGEIGLDGH RISTQFRGRA SGVVTTLVPP  360
PGKGFVTVTS VKTTDSMDGE DVASRPGPGA GRWHWAPGS*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.252681e-137panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO258041801e-137
Expression AtlasQ6IEL8-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os11g45920.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs11g45920
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1356440.0AC135644.2 Oryza sativa (japonica cultivar-group) chromosome 11 BAC clone OSJNBa0085H07, complete sequence.
GenBankAP0149670.0AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLQ6IEL80.0Q6IEL8_ORYSJ; WRKY transcription factor 63
STRINGLOC_Os11g45920.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1417875
MonocotsOGMP3095334
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G11070.22e-22WRKY family protein
Publications ? help Back to Top
  1. Zhang ZL, et al.
    A rice WRKY gene encodes a transcriptional repressor of the gibberellin signaling pathway in aleurone cells.
    Plant Physiol., 2004. 134(4): p. 1500-13
    [PMID:15047897]