PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os11g43740.1
Common NameOs11g0658700, OSNPB_110658700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family M-type_MADS
Protein Properties Length: 393aa    MW: 43366.9 Da    PI: 6.8292
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os11g43740.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF63.32.7e-201053245
                      ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
            SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                      + en+s r+vt+skRr gilKKA+ELS+LCd+   +++fs+++k
  LOC_Os11g43740.1 10 KLENSSGRHVTYSKRRSGILKKAKELSILCDIPLILLMFSPNDK 53
                      679*************************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.1E-26160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006623.254153IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.49E-24295IPR002100Transcription factor, MADS-box
PRINTSPR004043.6E-15323IPR002100Transcription factor, MADS-box
PfamPF003192.4E-171154IPR002100Transcription factor, MADS-box
PRINTSPR004043.6E-152338IPR002100Transcription factor, MADS-box
PRINTSPR004043.6E-153859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0025281anatomypollen
PO:0001015developmental stageK second mitotic division stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 393 aa     Download sequence    Send to blast
MGRVKLKIKK LENSSGRHVT YSKRRSGILK KAKELSILCD IPLILLMFSP NDKPTICVGD  60
HSSIEDVITK YAQQTPQERA KRKLESLEAL KKTFKKLDHD VNIQDFLGSG GQTVEMLIKS  120
IVWQELSSHL GALQCQMADV EKRLSYWSDP EKVENIDHIR AMEQSLKESL NRIRIHKENF  180
AKQHLMSLQC AAAQFQNDMK LPLGLTGDPN TSSWFHGGGG AEAQQPMMLP EDPSLLHQRD  240
IGCSASTSLQ SYPGYFSMGK QSTDNAGGGE QHHHAAVQQQ PEFSQADCLT SLQLGAQFPY  300
PSAFDNAGLL SDRLFDNAAA AAAAMDFGGH YDLPRPGDEA SFQNWASAAC GATMYDHQQQ  360
QQQQQQPAQL PAAATVEAPS FNHPSPHRQL MI*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.738060.0flower| panicle
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasA0A0P0Y4X8
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os11g43740.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs11g43740
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFM9565050.0FM956505.1 Oryza sativa Japonica Group mRNA for MADS68 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015618002.10.0PREDICTED: agamous-like MADS-box protein AGL65 isoform X1
TrEMBLA0A0P0Y4X80.0A0A0P0Y4X8_ORYSJ; Os11g0658700 protein
STRINGLOC_Os11g43740.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP59461119
MonocotsOGMP46263659
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18750.19e-83AGAMOUS-like 65