PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os11g39000.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family bHLH
Protein Properties Length: 101aa    MW: 10867.4 Da    PI: 7.3656
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os11g39000.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH28.33.2e-0923621554
                      HHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
               HLH 15 riNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
                      ++ + +++L+ +lP++ ++ + K s ae+L++A++YI+ L
  LOC_Os11g39000.2 23 QMAELISKLQAVLPTRGGEANAKASSAEVLQEACRYIRRL 62
                      78899**********88*********************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508888.55862IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474592.09E-82278IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000104.1E-62362IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.101.5E-72365IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0040008Biological Processregulation of growth
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 101 aa     Download sequence    Send to blast
MSSSRRSRTS SRLAAAPPPT DEQMAELISK LQAVLPTRGG EANAKASSAE VLQEACRYIR  60
RLHREADALS ERLAELLLLQ PSDLAINGAD VPDLIRSLLM *
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os11g39000.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs11g39000
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8332021e-169CT833202.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCEA029D09, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015616701.12e-64PREDICTED: transcription factor ILI2 isoform X2
SwissprotB8BLA37e-56ILI2_ORYSI; Transcription factor ILI2
SwissprotQ2R1J37e-56ILI2_ORYSJ; Transcription factor ILI2
TrEMBLA0A0D3HNS73e-64A0A0D3HNS7_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0HS143e-64A0A0E0HS14_ORYNI; Uncharacterized protein
STRINGBGIOSGA033734-PA2e-53(Oryza sativa Indica Group)
STRINGLOC_Os11g39000.12e-53(Oryza sativa Japonica Group)
STRINGORGLA11G0161400.12e-53(Oryza glaberrima)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39860.18e-11bHLH family protein