PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os11g35390.1
Common NameLOC4350727, Os11g0558200, OsJ_34262, OSNPB_110558200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 331aa    MW: 36061.2 Da    PI: 6.7416
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os11g35390.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.46.6e-181562148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+eEd +lv +++q+G+g+W+++++  g+ R+ k+c++rw +yl
  LOC_Os11g35390.1 15 KGPWTPEEDIILVSYIQQHGPGNWRSVPENTGLMRCSKSCRLRWTNYL 62
                      79********************************************97 PP

2Myb_DNA-binding47.15.4e-1568113148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg++T+ E+ +++++ ++lG++ W++Ia++++  Rt++++k++w+++l
  LOC_Os11g35390.1  68 RGNFTPHEEGIIIHLQALLGNK-WAAIASYLP-QRTDNDIKNYWNTHL 113
                       89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.6421066IPR017930Myb domain
SuperFamilySSF466891.67E-3012109IPR009057Homeodomain-like
SMARTSM007177.4E-141464IPR001005SANT/Myb domain
PfamPF002492.8E-161562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-231669IPR009057Homeodomain-like
CDDcd001672.29E-121762No hitNo description
PROSITE profilePS5129419.14867117IPR017930Myb domain
SMARTSM007172.4E-1367115IPR001005SANT/Myb domain
PfamPF002492.9E-1368113IPR001005SANT/Myb domain
CDDcd001677.12E-1070113No hitNo description
Gene3DG3DSA:1.10.10.601.5E-2470117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MGRPPCCDNG VGVKKGPWTP EEDIILVSYI QQHGPGNWRS VPENTGLMRC SKSCRLRWTN  60
YLRPGIKRGN FTPHEEGIII HLQALLGNKW AAIASYLPQR TDNDIKNYWN THLKKKVKRL  120
QQQQQSHPDH HHHHSFQTTP SSSNAAAVAT TSPNYYNPNN SNSNSSNYLH NNNHNLESMQ  180
SMATAPSNEA TTIPKLFQFQ TWMKPSPATT SSAATAAAGS CYKQAMAMQE LQEEQEGSAA  240
AAAMASSIDG VSKDQDYHMC AVISGDDKSS SSEMMTAAAM AGHGEAATTT FSLLENWLLD  300
DMPGQAAMSA AMDGFLEISA GYCCADPIMF *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A8e-26151174105MYB PROTO-ONCOGENE PROTEIN
1mse_C7e-26151174105C-Myb DNA-Binding Domain
1msf_C7e-26151174105C-Myb DNA-Binding Domain
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.570620.0leaf
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329960530.0
Expression AtlasQ2R2L6-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os11g35390.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs11g35390
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1108440.0AK110844.1 Oryza sativa Japonica Group cDNA clone:002-172-B09, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015618031.10.0PREDICTED: transcription factor MYB30
TrEMBLA2ZFC60.0A2ZFC6_ORYSI; Putative uncharacterized protein
TrEMBLQ2R2L60.0Q2R2L6_ORYSJ; Myb-like DNA-binding domain containing protein, expressed
STRINGBGIOSGA033804-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os11g35390.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP22938296
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08810.12e-79myb domain protein 60
Publications ? help Back to Top
  1. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]