PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os11g35030.1
Common NameGRF8, LOC4350711, Os11g0551900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GRF
Protein Properties Length: 410aa    MW: 43896.9 Da    PI: 8.8027
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os11g35030.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC71.97.2e-23159202245
               WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                        ep+rCrRtDGKkWRCsr++++++k+CErH++rgr+rsrk++e 
  LOC_Os11g35030.1 159 VEPRRCRRTDGKKWRCSRDAVGDQKYCERHINRGRHRSRKHVEG 202
                       59***************************************996 PP

2QLQ58.12.6e-20106142137
               QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                       ++FT++Q+++L++Q+l+yK++aan+ vP+ Ll++i++
  LOC_Os11g35030.1 106 GPFTPTQWMELEHQALIYKHIAANVSVPSSLLLPIRR 142
                       59*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009515.4E-12106142IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.1E-14107141IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.888107142IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.136158202IPR014977WRC domain
PfamPF088793.5E-19160201IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009049anatomyinflorescence
PO:0001083developmental stageinflorescence development stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
Sequence ? help
Protein Sequence    Length: 410 aa     Download sequence    Send to blast
MLSSCGGHGH GNPRSLQEEH HGRCGEQQGG GGGGGQEQEQ DGFLVREARA SPPSPSSSSF  60
LGSTSSSCSG GGGGGQMLSF SSPNGTAGLG LSSGGSMQGV LARVRGPFTP TQWMELEHQA  120
LIYKHIAANV SVPSSLLLPI RRSLHPWGWG SFPPGCADVE PRRCRRTDGK KWRCSRDAVG  180
DQKYCERHIN RGRHRSRKHV EGRKATLTIA EPSTVIAAGV SSRGHTVARQ KQVKGSAATV  240
SDPFSRQSNR KFLEKQNVVD QLSPMDSFDF SSTQSSPNYD NVALSPLKLH HDHDESYIGH  300
GAGSSSEKGS MMYESRLTVS KETLDDGPLG EVFKRKNCQS ASTEILTEKW TENPNLHCPS  360
GILQMATKFN SISSGNTVNS GGTAVENLIT DNGYLTARMM NPHIVPTLL*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.473950.0callus| panicle| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329882640.0
Expression AtlasQ6AWY1-
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that plays a regulatory role in gibberellin-induced stem elongation. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os11g35030.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs11g35030
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1030550.0AK103055.1 Oryza sativa Japonica Group cDNA clone:J033117J15, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015615703.10.0PREDICTED: growth-regulating factor 8
SwissprotQ6AWY10.0GRF8_ORYSJ; Growth-regulating factor 8
TrEMBLA0A0E0J3660.0A0A0E0J366_ORYNI; Uncharacterized protein
STRINGLOC_Os11g35030.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1468944
MonocotsOGMP129602731
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.12e-37growth-regulating factor 2
Publications ? help Back to Top
  1. Choi D,Kim JH,Kende H
    Whole genome analysis of the OsGRF gene family encoding plant-specific putative transcription activators in rice (Oryza sativa L.).
    Plant Cell Physiol., 2004. 45(7): p. 897-904
    [PMID:15295073]
  2. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]