PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os11g34200.1
Common NameLOC4350685, Os11g0544700, OsJ_34182, OSNPB_110544700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NF-YC
Protein Properties Length: 259aa    MW: 28254.5 Da    PI: 5.1115
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os11g34200.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC59.76e-197861998
             NF-YC 19 helPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98
                      +++P arikki++adedv +i+  +Pvl+s+a elf+ +l  r++  + ++  +tl+   ++++v r   fdfl+++v +
  LOC_Os11g34200.1  7 TRFPAARIKKIMQADEDVGKIALAVPVLVSRALELFLQDLIDRTYEITLQSGAKTLNSFHLKQCVRRYSSFDFLTEVVNK 86
                      579************************************************************************99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.107.1E-26372IPR009072Histone-fold
SuperFamilySSF471132.0E-20499IPR009072Histone-fold
PfamPF008086.1E-19871IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009049anatomyinflorescence
PO:0001083developmental stageinflorescence development stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MRKKLGTRFP AARIKKIMQA DEDVGKIALA VPVLVSRALE LFLQDLIDRT YEITLQSGAK  60
TLNSFHLKQC VRRYSSFDFL TEVVNKVPDL GGADSCGDDR ALPRRRKALP NGSDPENEES  120
RSSKMAVRSA NISPRGRGRG RGRGRGRPPT KRKEVGYVQF EDESSMFADQ GEALPGEETV  180
PETIHGTESV PPSTHPPAEA PSAAEIPAPN PKVEEAKNDD HQPDWPMPDA IGNIGVGPSG  240
FGHLTVQVDE DEDYDNED*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_A2e-23271574Transcription Regulator NC2 alpha chain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1102106PRRRK
2136145RGRGRGRGRG
3136146RGRGRGRGRGR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.67870.0flower| panicle| root| stem| vegetative meristem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1166360950.0
Expression AtlasQ2R2Z2-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os11g34200.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs11g34200
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4649040.0AF464904.1 Oryza sativa repressor protein (DrAp1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015615139.10.0PREDICTED: dr1-associated corepressor
TrEMBLI1R0U90.0I1R0U9_ORYGL; Uncharacterized protein
TrEMBLQ2R2Z20.0Q2R2Z2_ORYSJ; CCAAT transcription factor
TrEMBLQ8W0W70.0Q8W0W7_ORYSA; Repressor protein
STRINGLOC_Os11g34200.10.0(Oryza sativa Japonica Group)
STRINGORGLA11G0139100.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP21791635
MonocotsOGMP21723679
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12480.11e-53nuclear factor Y, subunit C11
Publications ? help Back to Top
  1. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]