PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os11g32110.2
Common NameLOC4350610
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family ARF
Protein Properties Length: 853aa    MW: 93912.5 Da    PI: 6.7931
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os11g32110.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B374.81e-23148249199
                       EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
                B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87 
                       f+k+lt sd++++g +++ +++a+e+      + + + +++l+ +d++g +W++++i+r++++r++l++GW+ Fv+a++L +gD ++F   + 
  LOC_Os11g32110.2 148 FCKTLTASDTSTHGGFSVLRRHADEClppldmSRQ-PPTQELVAKDLHGVEWRFRHIFRGQPRRHLLQSGWSVFVSAKRLVAGDAFIFL--RG 237
                       99*****************************7333.34459************************************************..44 PP

                       SEE..EEEEE-S CS
                B3  88 sefelvvkvfrk 99 
                       +++el+v+v+r+
  LOC_Os11g32110.2 238 ENGELRVGVRRA 249
                       9999*****996 PP

2Auxin_resp116.91.7e-38274356183
        Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                       a+ha++t+++F+v+Y+Pr+s++eFvv++++++++lk+++s+GmRfkm+fe+e+++e+r++Gt+vg+ d+dp  Wp+SkWrsLk
  LOC_Os11g32110.2 274 AWHAVNTGTMFTVYYKPRTSPAEFVVPYDRYMESLKQNYSIGMRFKMRFEGEEAPEQRFTGTIVGMGDSDPAGWPESKWRSLK 356
                       89*******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.103.2E-42141263IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.02E-41143277IPR015300DNA-binding pseudobarrel domain
CDDcd100177.25E-22146248No hitNo description
SMARTSM010199.9E-24148250IPR003340B3 DNA binding domain
PfamPF023621.3E-21148249IPR003340B3 DNA binding domain
PROSITE profilePS5086311.899148250IPR003340B3 DNA binding domain
PfamPF065078.4E-36274356IPR010525Auxin response factor
SuperFamilySSF542771.47E-11719800No hitNo description
PROSITE profilePS5174521.936724808IPR000270PB1 domain
PfamPF023092.2E-6770808IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 853 aa     Download sequence    Send to blast
MATAEVGGGG GEGDAAAAAV ARGGGGGGGG GGGEDALFTE LWSACAGPLV TVPRVGEKVF  60
YFPQGHIEQV EASTNQVGEQ RMQLYNLPWK ILCEVMNVEL KAEPDTDEVY AQLTLLPESK  120
QQEDNGSTEE EVPSAPAAGH VRPRVHSFCK TLTASDTSTH GGFSVLRRHA DECLPPLDMS  180
RQPPTQELVA KDLHGVEWRF RHIFRGQPRR HLLQSGWSVF VSAKRLVAGD AFIFLRGENG  240
ELRVGVRRAM RQQTNVPSSV ISSHSMHLGV LATAWHAVNT GTMFTVYYKP RTSPAEFVVP  300
YDRYMESLKQ NYSIGMRFKM RFEGEEAPEQ RFTGTIVGMG DSDPAGWPES KWRSLKVRWD  360
EASSIPRPER VSPWQIEPAV SPPPVNPLPV PRTKRLRPNA TALPADSSAI AKEAATKVVV  420
ESEPNGTQRT FQTQENATPK SGFGNSSELE SAQKSIMRPS GFDREKNNTP IQWKLGSDGR  480
MQMSKPESYS EMLSGFQPPK DVQIPQGFCS LPEQITAGHS NFWHTVNAQY QDQQSNHNMF  540
PSSWSFMPPN TRLGLNKQNY SMIQEAGVLS QRPGNTKFGN GVYAALPGRG TEQYSGGWFG  600
HMMPNSHMDD TQPRLIKPKP LVVAHGDVQK AKGASCKLFG IHLDSPAKSE PLKSPSSVVY  660
DGTPQTPGAT EWRRPDVTEV EKCSDPSKAM KPLDTPQPDS VPEKPSSQQA SRNMSCKSQG  720
VSTRSCKKVH KQGIALGRSV DLTKFNGYEE LIAELDDMFD FNGELKGPKK EWMVVYTDNE  780
GDMMLVGDDP WIEFCDMVHK IFIYTREEVQ RMNPGTLNSR SEDSHANSME RGSVGREMRG  840
CLSTSSLNSE NC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-178213783354Auxin response factor 1
4ldw_A1e-178213783354Auxin response factor 1
4ldw_B1e-178213783354Auxin response factor 1
4ldx_A1e-178213783354Auxin response factor 1
4ldx_B1e-178213783354Auxin response factor 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.108170.0callus| flower| leaf| panicle| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329820200.0
Expression AtlasF4MGC6-
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os11g32110.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs11g32110
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ3063060.0AJ306306.1 Oryza sativa subsp. japonica mRNA for auxin response factor 1 (arf1 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015617188.10.0PREDICTED: auxin response factor 23 isoform X2
SwissprotQ2R3F50.0ARFW_ORYSJ; Auxin response factor 23
TrEMBLF4MGC60.0F4MGC6_ORYSJ; Auxin response factor
STRINGLOC_Os11g32110.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62000.30.0auxin response factor 2
Publications ? help Back to Top
  1. Waller F,Furuya M,Nick P
    OsARF1, an auxin response factor from rice, is auxin-regulated and classifies as a primary auxin responsive gene.
    Plant Mol. Biol., 2002. 50(3): p. 415-25
    [PMID:12369618]
  2. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]