PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os11g31380.1
Common NameOsJ_34016
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NAC
Protein Properties Length: 241aa    MW: 26253.9 Da    PI: 6.5016
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os11g31380.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM22.14.1e-071049848
               NAM  8 hPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48
                      hPt+ elv +yL +++ + +l+  e+i +v+++ ++Pwd+ 
  LOC_Os11g31380.1 10 HPTEGELVFHYLYRRAVNMPLPS-EFICDVNVLPHNPWDIV 49
                      9********************99.89*************94 PP

2NAM28.25.5e-09519787128
               NAM  87 gkdkevlsk..kgel.....vglkktLvfykgrapkgektdWvmheyrl 128
                       g++k+v+ +  +        vg+++tL+fy g+++++e+t+W m+e+rl
  LOC_Os11g31380.1  51 GSEKPVYYNqgG--GsdcmlVGMRRTLTFYFGNSRTAERTKWGMQEFRL 97 
                       667777776441..234455***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100511.3681166IPR003441NAC domain
SuperFamilySSF1019411.57E-209107IPR003441NAC domain
PfamPF023651.3E-71097IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MHLPAVGMSH PTEGELVFHY LYRRAVNMPL PSEFICDVNV LPHNPWDIVP GSEKPVYYNQ  60
GGGSDCMLVG MRRTLTFYFG NSRTAERTKW GMQEFRLAGN GLSPYPAMKH ATGDGSKPPC  120
NCAETTIAKR NDGLSAVLRN VLAVTPLVET VVEPDGSWLI CRIYRTRQRA LPVITPPAIE  180
NAREIIIPPA NGNAREAQVR FIDFLQQGSH IESSSPCSCI VGPSLAEGSD ESAGSVDQKD  240
*
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasB9GAV6
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os11g31380.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs11g31380
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ9401960.0FJ940196.1 Oryza sativa Japonica Group clone KCS246C06 NAM protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015615934.17e-83PREDICTED: NAC transcription factor 25
TrEMBLB9GAV60.0B9GAV6_ORYSJ; Uncharacterized protein
STRINGLOC_Os11g31380.11e-180(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1240326
MonocotsOGMP44822369
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04070.13e-13NAC domain containing protein 47