PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os11g31370.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NAC
Protein Properties Length: 127aa    MW: 14458.6 Da    PI: 8.1475
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os11g31370.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM26.91.4e-0811653286
               NAM 32 evikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86
                      ++i+++di++++P d+  + +++++  +fF++++kk++ ++ +n a+  g+W+++
  LOC_Os11g31370.1 11 DFITDIDILHHNPLDIVPTRQEKKNGKHFFTRKEKKHHGDNCRNHAAGVGFWRKS 65
                      679*************63445667799*********99999999999*****986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.62E-10685IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 127 aa     Download sequence    Send to blast
MAGPQMSLPY DFITDIDILH HNPLDIVPTR QEKKNGKHFF TRKEKKHHGD NCRNHAAGVG  60
FWRKSSFAES MEWAMQEFQL AGSYLLPCFV MRFATSDGTE QPFGCTRVTI ANMRHCILTP  120
YCCFIG*
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ2R3N1
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os11g31370.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs11g31370
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126191e-104CP012619.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 11 sequence.
GenBankAC1361501e-104AC136150.4 Oryza sativa Japonica Group cultivar Nipponbare chromosome 11 clone OSJNBa0023F12, complete sequence.
GenBankAP0149671e-104AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015615934.12e-28PREDICTED: NAC transcription factor 25
TrEMBLQ2R3N19e-94Q2R3N1_ORYSJ; Uncharacterized protein
STRINGLOC_Os11g31370.13e-93(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1240326
MonocotsOGMP5298522
Publications ? help Back to Top
  1. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]