PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os11g31360.1
Common NameOsJ_34015
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NAC
Protein Properties Length: 291aa    MW: 32255.2 Da    PI: 9.3513
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os11g31360.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM94.22.2e-29191442124
               NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                        +G+ F+Pt+ elvv+yL +++ +++l++ ++i++vdi  ++Pw++   + ++++  +fF++++++++++ ++n a+ +g+W+  g++ ++++
  LOC_Os11g31360.1  19 SVGCVFRPTEGELVVNYLYRRAMQEPLPC-DFITDVDIQCHNPWEIV-PAGEKKNGKHFFTRKENSHPRDYESNHAAGDGFWRLAGTEVPIYN 109
                       68***************************.99**************5.455667899************************************ PP

               NAM  95 k.....kgelvglkktLvfykgrapkgektdWvmh 124
                       k     +++lvg+k+tLvf+  +++++e+t Wvm 
  LOC_Os11g31360.1 110 KpsggaDEKLVGMKRTLVFHFRKSSSTERTGWVMP 144
                       *999988889**********9999**********6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.53E-3015145IPR003441NAC domain
PROSITE profilePS5100528.88718213IPR003441NAC domain
PfamPF023651.0E-1420143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MAGPGVCINL LNGTTMHLSV GCVFRPTEGE LVVNYLYRRA MQEPLPCDFI TDVDIQCHNP  60
WEIVPAGEKK NGKHFFTRKE NSHPRDYESN HAAGDGFWRL AGTEVPIYNK PSGGADEKLV  120
GMKRTLVFHF RKSSSTERTG WVMPTCRCQP CALPCDEAGH RCHLYHGCTL IDYMRTVLQK  180
NNGSPSAAHT HAPLVETMVE PDNSWMICRI YKKRQRAPQV IIPPSIGNAR EAVLAVPAIG  240
NAGDRQVTSL TSQGIDVSRR GVMSLPMSSQ RTRAVMVMGR TNRRKKLGLV *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-161414811140Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.917690.0seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1127871570.0
Expression AtlasQ2R3N2-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os11g31360.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs11g31360
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1361500.0AC136150.4 Oryza sativa Japonica Group cultivar Nipponbare chromosome 11 clone OSJNBa0023F12, complete sequence.
GenBankAP0149670.0AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015697669.11e-96PREDICTED: NAC transcription factor NAM-B1-like
TrEMBLA0A0E0R8V30.0A0A0E0R8V3_ORYRU; Uncharacterized protein
TrEMBLQ2R3N20.0Q2R3N2_ORYSJ; No apical meristem protein, expressed
STRINGLOC_Os11g31360.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1240326
MonocotsOGMP44822369
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77450.13e-22NAC domain containing protein 32
Publications ? help Back to Top
  1. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]