PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os11g31340.1
Common NameLOC9266935, Os11g0512100, OsJ_34014, OSNPB_110512100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NAC
Protein Properties Length: 278aa    MW: 30334.2 Da    PI: 6.5818
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os11g31340.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM99.93.7e-31191419128
               NAM   9 PtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.....k 96 
                       Pt+ +lvv+yL++++ ++++++ ++i++vdi++++Pwd+   ++++++  yfF++++++   ++++nra+ +g+W+  g++ ++++k     +
  LOC_Os11g31340.1  19 PTNADLVVHYLHRRAIQEPVPC-DFITNVDILQHNPWDIV-PAEEKTNGKYFFIHEENERLGNHHSNRAAGDGFWRPVGSEVPIYHKrsggaD 109
                       9*********************.99**************5.455677899**********99************************9887777 PP

               NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                       ++lvg+k+tLvf+ g+++++++t+Wvm+e+rl
  LOC_Os11g31340.1 110 EALVGMKRTLVFHYGNSSSAKRTEWVMQEFRL 141
                       777***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100529.03111207IPR003441NAC domain
SuperFamilySSF1019411.29E-3018146IPR003441NAC domain
PfamPF023653.5E-1519141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009089anatomyendosperm
PO:0007042developmental stagewhole plant fruit formation stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MASPGVCINL VNGTSTRLPT NADLVVHYLH RRAIQEPVPC DFITNVDILQ HNPWDIVPAE  60
EKTNGKYFFI HEENERLGNH HSNRAAGDGF WRPVGSEVPI YHKRSGGADE ALVGMKRTLV  120
FHYGNSSSAK RTEWVMQEFR LAGATLIPCP VTRPATGDGS MLPCHRTGTT IATENNGSPS  180
AGQTHGPLEK TMVEPDSSLR ICRIYKKRQR TPQFIIPPSI GDARELILAL PTIGNTREVA  240
LALPAIDFLG QPSFEEGSDV SADVITDDKD GYGHGMN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-171914123140Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.942650.0panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2977283860.0
Expression AtlasQ2R3N4-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os11g31340.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs11g31340
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU8470010.0EU847001.1 Oryza sativa Japonica Group clone KCS322B05 NAM protein mRNA, complete cds.
GenBankAK2420100.0AK242010.1 Oryza sativa Japonica Group cDNA, clone: J075106F03, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015616648.10.0PREDICTED: NAC transcription factor NAM-1
TrEMBLA0A0E0R8V20.0A0A0E0R8V2_ORYRU; Uncharacterized protein
TrEMBLQ2R3N40.0Q2R3N4_ORYSJ; NAM protein
STRINGLOC_Os11g31340.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1240326
MonocotsOGMP44822369
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10490.17e-24NAC domain containing protein 52
Publications ? help Back to Top
  1. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]