PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os11g31330.1
Common NameLOC4350574, Os11g0512000, OsJ_34013, OSNPB_110512000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NAC
Protein Properties Length: 301aa    MW: 32983.5 Da    PI: 6.8377
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os11g31330.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM119.82.6e-37181481128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                       l pGfrF+Ptd+elv +yL +++ + +l++  +i++vdi++++Pwd+   v+++ek  +fF++++ ky+ ++r+nr++ +g+W+a g++ +++
  LOC_Os11g31330.1  18 LLPGFRFRPTDDELVIKYLYPRAFHVPLPC-AIITDVDIHHHNPWDIV-PVAEREKGKHFFTRKEVKYPGSRRSNRVAGNGFWRAAGSEVPIY 108
                       579***************************.88**************5.567789999*********************************** PP

               NAM  94 sk.....kgelvglkktLvfykgrapkgektdWvmheyrl 128
                        k     ++ lvg+++tLvf+ g+++++e+t+W mhe++l
  LOC_Os11g31330.1 109 YKpegaaNDMLVGMRRTLVFHYGKSRSAERTEWAMHEFQL 148
                       *9887777777***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.36E-4112155IPR003441NAC domain
PROSITE profilePS5100539.16718217IPR003441NAC domain
PfamPF023651.3E-1920148IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009089anatomyendosperm
PO:0007042developmental stagewhole plant fruit formation stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MANTGLSIPM VNGATIHLLP GFRFRPTDDE LVIKYLYPRA FHVPLPCAII TDVDIHHHNP  60
WDIVPVAERE KGKHFFTRKE VKYPGSRRSN RVAGNGFWRA AGSEVPIYYK PEGAANDMLV  120
GMRRTLVFHY GKSRSAERTE WAMHEFQLAG AGLLPHPMMR HATSNGSEPP CGCLEATIAK  180
KSDGLSATLR AKRDSAPLMR IMVEPDSSWV ICCIYKKRQR APPVVIPPVI GDVGEAIIPH  240
AIGDAREGQL HFIDFLGQPA RNDPSSPHSC TIDPSSLEEG SDESAGDGED KDGDGMNEAN  300
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-281414811140Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.876990.0callus| flower| panicle| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2139591380.0
Expression AtlasQ2R3N5-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os11g31330.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs11g31330
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1073690.0AK107369.1 Oryza sativa Japonica Group cDNA clone:002-127-B02, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015615934.10.0PREDICTED: NAC transcription factor 25
TrEMBLA0A0E0R8V10.0A0A0E0R8V1_ORYRU; Uncharacterized protein
TrEMBLQ2R3N50.0Q2R3N5_ORYSJ; No apical meristem protein, expressed
STRINGLOC_Os11g31330.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1240326
MonocotsOGMP44822369
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13180.12e-34NAC domain containing protein 83
Publications ? help Back to Top
  1. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]