PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os11g31100.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GRAS
Protein Properties Length: 773aa    MW: 81094.4 Da    PI: 6.6528
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os11g31100.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS427.41.2e-1304017711374
              GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn......sseelaalklfsev 87 
                       lv+lLl+cA+ vs+gd+ +a + L  l+  asp gd+mqR+a++f+ ALaarl+  +s ++++ +p++++         s e+l+++++++++
  LOC_Os11g31100.1 401 LVHLLLACADLVSKGDHPAALRHLHLLRRVASPLGDSMQRVASHFADALAARLSLLSSPTSASPSPRAAAAAApypfppSPETLKVYQILYQA 493
                       68****************************************************9888888888888888777899***************** PP

              GRAS  88 sPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnv 180
                       +P++kf+h+taNqaI ea++ge+rvH++D+di qG QWpa+lqaLa+Rp+gpp+lR+Tgvg+       +++etg+ La++A++l+vpfef++
  LOC_Os11g31100.1 494 CPYIKFAHFTANQAIFEAFHGEDRVHVVDLDILQGYQWPAFLQALAARPGGPPTLRLTGVGH----PPAAVRETGRHLASLAASLRVPFEFHA 582
                       **************************************************************....99************************* PP

              GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdslea 273
                        +a+rle l++ +L+ + gEalaVn v +lhr++      +s+ + +L+++++  Pk++++veqea hn++ Fl rfleal+yysa+fdsl+a
  LOC_Os11g31100.1 583 AAADRLERLRPAALHRRVGEALAVNAVNRLHRVP------SSHLPPLLSMIRDQAPKIITLVEQEAAHNGPYFLGRFLEALHYYSAIFDSLDA 669
                       9999*****************************9......445566*********************************************** PP

              GRAS 274 klpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdr 365
                       ++p+es +r+kvE+ ll++ei+nvvacegaer++rhe+le+Wr+ +e  GF++vpls  a+ q + ll  ++ +dgyr+ e+sg+l+lgW+dr
  LOC_Os11g31100.1 670 TFPAESTARMKVEQCLLAPEIRNVVACEGAERVARHERLERWRRLMEGRGFEAVPLSAAAVGQSQVLLGLYGaGDGYRLTEDSGCLLLGWQDR 762
                       ********************************************************************************************* PP

              GRAS 366 pLvsvSaWr 374
                       +++++SaWr
  LOC_Os11g31100.1 763 AIIAASAWR 771
                       ********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098567.536375750IPR005202Transcription factor GRAS
PfamPF035144.0E-128401771IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 773 aa     Download sequence    Send to blast
MAGGGAKLQQ QQAPTSPTAS VSESNIVAST ASADPEANDA LAGLQALRFD GGGDIDDVEI  60
QSPDIALWES IFADQIGVSG AGADFLLSMS SAAASPRRDF MACSPKRDYM VTTSSPKRDY  120
MVTSSPKRDY MVSSPKREYM VTSPRREMAT SPRRATFSNL YTSSHGGGGG GGHHLHHQSY  180
VHGGGMEGGG GGHGAQPQYG GLAGHGKGKA QSPLHKVYIN NVGGGSGGGG VKSNTPSTLS  240
CASSYVVHGG ESGLPSLPSM DPFLEEGYLG SYQLPEKAAG GVGGGGGGDI NRSGASVSVV  300
TAPASSQLLP TLSECLAMPE PAAYRGGGDE AVAAAMAVAG ELPVGAFVQP EMYYGGGGEF  360
GGEGMTPPLQ HQMAADSSLH SMLGSVIQSE AEQEQDSGLQ LVHLLLACAD LVSKGDHPAA  420
LRHLHLLRRV ASPLGDSMQR VASHFADALA ARLSLLSSPT SASPSPRAAA AAAPYPFPPS  480
PETLKVYQIL YQACPYIKFA HFTANQAIFE AFHGEDRVHV VDLDILQGYQ WPAFLQALAA  540
RPGGPPTLRL TGVGHPPAAV RETGRHLASL AASLRVPFEF HAAAADRLER LRPAALHRRV  600
GEALAVNAVN RLHRVPSSHL PPLLSMIRDQ APKIITLVEQ EAAHNGPYFL GRFLEALHYY  660
SAIFDSLDAT FPAESTARMK VEQCLLAPEI RNVVACEGAE RVARHERLER WRRLMEGRGF  720
EAVPLSAAAV GQSQVLLGLY GAGDGYRLTE DSGCLLLGWQ DRAIIAASAW RC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-554017714375GRAS family transcription factor containing p
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ2R3Q8
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os11g31100.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs11g31100
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1377590.0AC137759.4 Oryza sativa Japonica Group chromosome 11 clone OSJNBb0008H02, complete sequence.
GenBankAC1363770.0AC136377.4 Oryza sativa Japonica Group chromosome 11 clone OSJNBa0028G07, complete sequence.
GenBankAP0149670.0AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015616711.10.0PREDICTED: DELLA protein RHT-1-like
TrEMBLQ2R3Q80.0Q2R3Q8_ORYSJ; GRAS family transcription factor containing protein
STRINGLOC_Os11g31100.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP53661322
MonocotsOGMP92213141
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.12e-92RGA-like 1
Publications ? help Back to Top
  1. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]