PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os11g30370.1
Common NameLOC107276349, Os11g0496600, Os11g0496700, OsJ_032640, SPL19
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family SBP
Protein Properties Length: 353aa    MW: 36657.7 Da    PI: 8.3486
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os11g30370.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.71.1e-4093169278
                       -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
               SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                       C v+gC++dls++++yhrrhkvCe+h+k+pvv+v+g+eqrfCqqCsrfh+l efD++k+sCr+rL++hn+rrrk+q+
  LOC_Os11g30370.1  93 CSVDGCRSDLSRCRDYHRRHKVCEAHAKTPVVVVAGQEQRFCQQCSRFHNLAEFDDGKKSCRKRLDGHNRRRRKPQH 169
                       **************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.107.7E-3486154IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.94190167IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.71E-3892171IPR004333Transcription factor, SBP-box
PfamPF031107.8E-3193166IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046872Molecular Functionmetal ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MEWAAAATKA ASWGMAVAAA AAADDAGPTM LSFAGPSSSS SSPDAAAAAA AAAAAALHDF  60
SVRARPAAAA PATRRARGGS GGGGGGGGGA EACSVDGCRS DLSRCRDYHR RHKVCEAHAK  120
TPVVVVAGQE QRFCQQCSRF HNLAEFDDGK KSCRKRLDGH NRRRRKPQHD ALNPRSFLPY  180
HQANQFSVYP QTFPIADQNA DALMRPLDRH PPFSISFSGT FREPKQFPFM QDGGSGLGAA  240
RHDLLRPFSS PEDGANITTT RSACNGVPHG LDPECALSLL SSSLHPSPAA GISSATAPPQ  300
FAPSSFSRIA ASSQAVTTAF ASDGGSVAGD HVLVPAVTYE DPSQAMPFSW QV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A8e-3083166184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1149166KKSCRKRLDGHNRRRRKP
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ2R3Y1
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os11g30370.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs11g30370
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1355690.0AC135569.6 Oryza sativa Japonica Group chromosome 11 clone OSJNBb0018F17, complete sequence.
GenBankAC1336080.0AC133608.4 Oryza sativa Japonica Group chromosome 11 clone OSJNBb0085G12, complete sequence.
GenBankAP0149670.0AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015617950.10.0PREDICTED: putative squamosa promoter-binding-like protein 19
SwissprotQ2R3Y10.0SPL19_ORYSJ; Putative squamosa promoter-binding-like protein 19
TrEMBLI1R0C40.0I1R0C4_ORYGL; Uncharacterized protein
STRINGLOC_Os11g30370.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9717230
MonocotsOGMP129612532
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.11e-39SBP family protein
Publications ? help Back to Top
  1. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]
  2. Xie K,Wu C,Xiong L
    Genomic organization, differential expression, and interaction of SQUAMOSA promoter-binding-like transcription factors and microRNA156 in rice.
    Plant Physiol., 2006. 142(1): p. 280-93
    [PMID:16861571]
  3. Yang Z, et al.
    Comparative study of SBP-box gene family in Arabidopsis and rice.
    Gene, 2008. 407(1-2): p. 1-11
    [PMID:17629421]