PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os11g29870.1
Common NameLOC4350545, Os11g0490900, OsJ_33930, OSNPB_110490900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family WRKY
Protein Properties Length: 243aa    MW: 25857.2 Da    PI: 9.3347
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os11g29870.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY106.41.5e-33136194159
                       ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       ldDgy+WrKYGqK vk+++fprsYYrCt++gC+vkk+v+r ++d++vv++tYeg+H+h+
  LOC_Os11g29870.1 136 LDDGYRWRKYGQKAVKNNKFPRSYYRCTHQGCNVKKQVQRLSRDETVVVTTYEGTHTHP 194
                       59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.805.4E-35121194IPR003657WRKY domain
SuperFamilySSF1182908.5E-30128195IPR003657WRKY domain
PROSITE profilePS5081130.343131196IPR003657WRKY domain
SMARTSM007749.1E-40136195IPR003657WRKY domain
PfamPF031062.1E-27137194IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000122Biological Processnegative regulation of transcription from RNA polymerase II promoter
GO:0010055Biological Processatrichoblast differentiation
GO:0032107Biological Processregulation of response to nutrient levels
GO:0043620Biological Processregulation of DNA-templated transcription in response to stress
GO:0048527Biological Processlateral root development
GO:0005634Cellular Componentnucleus
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MENFPILFAT QPTSSSTSSS YHFMSSSSGS HDHRHHHGLQ AGGNGGGGGG SLSHGLFMGS  60
SSSSIRMEEL SNSKQAGDVV VDGGATRSPH GGDGDGAAGD DGGDAQAAAA GGRKKGEKKE  120
RRPRFAFQTR SQVDILDDGY RWRKYGQKAV KNNKFPRSYY RCTHQGCNVK KQVQRLSRDE  180
TVVVTTYEGT HTHPIEKSND NFEHILTQMH IYSGLTPSSA AHASSSSPLF PSAAAAASHM  240
FQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-27127195876Probable WRKY transcription factor 4
2lex_A1e-27127195876Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.558275e-51leaf| root
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ2R432
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00506DAPTransfer from AT5G13080Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os11g29870.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs11g29870
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1088600.0AK108860.1 Oryza sativa Japonica Group cDNA clone:002-152-B08, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015615223.11e-180PREDICTED: probable WRKY transcription factor 56
TrEMBLA0A0E0J1Z11e-180A0A0E0J1Z1_ORYNI; Uncharacterized protein
TrEMBLQ2R4321e-180Q2R432_ORYSJ; Os11g0490900 protein
STRINGLOC_Os11g29870.11e-180(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1417875
MonocotsOGMP110038133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.16e-55WRKY DNA-binding protein 75
Publications ? help Back to Top
  1. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]