PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os11g16290.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Nin-like
Protein Properties Length: 859aa    MW: 94889.6 Da    PI: 7.0227
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os11g16290.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.72.6e-29532582252
            RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                       ek++sl++l++yFs+++kdAAk++gvc+T+LKriCRq+GI+RWP+Rkik++
  LOC_Os11g16290.2 532 EKSVSLSVLQQYFSGSLKDAAKSIGVCPTTLKRICRQHGISRWPSRKIKKV 582
                       799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.348521602IPR003035RWP-RK domain
PfamPF020423.8E-26535582IPR003035RWP-RK domain
SuperFamilySSF542771.11E-23751846No hitNo description
Gene3DG3DSA:3.10.20.2405.6E-25757839No hitNo description
PfamPF005649.1E-19760841IPR000270PB1 domain
SMARTSM006667.1E-26760842IPR000270PB1 domain
PROSITE profilePS5174527.157760842IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 859 aa     Download sequence    Send to blast
MDMLMLSSAL DGLDSYTDLV AGSSVADSIF SALTCFPPSQ ERLLHVSTPV GSNSRQDDSD  60
VSITKEGTTT RRGDCAAGLA SGEPVAAGIG SVPKPFDGVT LTERMLRALA MLKEASGGEA  120
ILVQVWMPVR NGEQHVLTTS DQPFLLDQKL TGYREVSRQF TFSAEEGPGL FPGLPGRVFM  180
SGMPEWTSNV MYYHGSEYLR VDYARRHEVR GSLAMPVFNS SGGSCCAVLE VVMTREKDNF  240
CLEMVNVSNA LQSVQLSTVN AWRHSQSYSR DQKLALMEIF DVLQAVCQAH LLPLALAWIP  300
VCSKRDVLVS VEYGANFGKR NKEVLCIEES ACYVNDTRMR DFVQVCAEHP LEKGQGVAGN  360
AYLSNNPFFS SDVKDYDMHA YPLVNHARKF GLHAAVAIRL QSTYTKNDDY VLEFFLPVLC  420
KGGGEQQLLL DSISATMRRV CKSLRTVSDA ELKEDVTRKP SNENRSGTRC PSPVNLIYSG  480
REIDVSNETK TNTPLEYQIE GIDEQLSDTK STNKLIKCSN ASDGEKRRSS TEKSVSLSVL  540
QQYFSGSLKD AAKSIGVCPT TLKRICRQHG ISRWPSRKIK KVNRSLKKIQ NVISSVHGVE  600
GVLKYDPSTG CLVSSVSPSI EPVLMNVEHK GQDVLHKLQN KQNGEINFDM DDGELFRNSH  660
STRTLSGAFC EDMPNGLYVA REMTCVAKTG TRTERLEHKP SSRDSFSAPQ EYRMESETDK  720
SNKNSKQSLP SSSSMTDCST SSGETFKSIK SQSANESNKT VVVKASYKND TIRFKLLPSM  780
KYEQLLEEIA KRLKLSIGLF QLKYKDDEGD WVILASDADL QECLEILDTT RLRILKLQVQ  840
DVVCPIGSSS GSCSMLRP*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.100840.0callus| flower| leaf| panicle| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329748770.0
Expression AtlasQ2R7K5-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os11g16290.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs11g16290
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0648590.0AK064859.1 Oryza sativa Japonica Group cDNA clone:J013000H14, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015616882.10.0PREDICTED: protein NLP2-like isoform X2
TrEMBLQ2R7K50.0Q2R7K5_ORYSJ; RWP-RK domain containing protein, expressed
STRINGLOC_Os11g16290.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59580.21e-179Nin-like family protein
Publications ? help Back to Top
  1. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]