PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os11g15755.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family FAR1
Protein Properties Length: 649aa    MW: 74181.8 Da    PI: 9.3792
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os11g15755.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR139.51.9e-1287134149
              FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkkte 49 
                       +fYn+YA+++GFs+r+s+ ++ k+++ i++rtf+Cs+ g++ ++k++ +
  LOC_Os11g15755.1  87 DFYNAYARDMGFSIRRSSCHYVKDSTIIKNRTFCCSRAGTHGHDKRE-D 134
                       6****************************************999887.3 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031016.9E-787133IPR004330FAR1 DNA binding domain
PfamPF105511.2E-12213262IPR018289MULE transposase domain
PROSITE profilePS509669.347437484IPR007527Zinc finger, SWIM-type
PfamPF044346.4E-6458481IPR007527Zinc finger, SWIM-type
SMARTSM005754.5E-7459486IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 649 aa     Download sequence    Send to blast
MASLSNLPRS IKVTDSLHEQ VTTMSTEPAA SAETSVLHHP GTSFHGNLEG ELETDPSKIE  60
ATPQADPSKG KAPIIGMKFN SEQEAYDFYN AYARDMGFSI RRSSCHYVKD STIIKNRTFC  120
CSRAGTHGHD KREDQISNYE FLHEHNHILA TGSQALYLRS QRKITEAQMA SVENAKSVGI  180
SNKATIDLMA KEAGGYENLG FTREDMKNRL YSKRSLKTFL KAMSGKKPQT ILTGEDAAMA  240
KAIKLVMPES HHRICVWHMN QNACKHLAGV VKEYKKFNAD FQNCIYDKEE EDEFINAWNR  300
MLEKYDLQEN KWLERLFQKK VQWALVYGRN TFSADMSGTQ RSESMNNELK GYISVKYDIL  360
TFLEHFDRLL SDKRYEEVKN DFKTTQSTPW PKADLTILRQ ATRIYTPAIF KVFQEQVLQT  420
LNCDLYYCGD IDAKMVYKLK VHSKHHEHIV KFSPTEDKVR CSCKKFEFLG ILCCHALKIL  480
DVNNIKEIPK QYILQRWTID AKSLHIKSNC STQEDPKIKL STRRRDLCRM FVKIASRATE  540
SDETYLMAAN NAQKLAENVE KYLSIRPDQD LDKSGIEENV GLSKARGIKV KEKAIRGSRR  600
PIGGFDKATQ RSKKKKSDSN TSKCPVQAEV LDRLSRAVGL VRLQLLVW*
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os11g15755.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs11g15755
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149670.0AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012700611.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 7-like
TrEMBLQ2R8S00.0Q2R8S0_ORYSJ; Transposon protein, putative, unclassified
STRINGLOC_Os11g15755.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3012351
MonocotsOGMP1480722
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.17e-58FAR1-related sequence 5