PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os11g13930.1
Common NameOs11g0243300, ZHD4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family ZF-HD
Protein Properties Length: 418aa    MW: 43961.9 Da    PI: 7.617
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os11g13930.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer102.52.8e-32142196358
       ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                       +v+Y+eClkNhAa++Gg+a+DGCgEfmps geeg+ +alkC+ACgCHRnFHR+e +
  LOC_Os11g13930.1 142 AVKYRECLKNHAAAIGGNATDGCGEFMPS-GEEGSLEALKCSACGCHRNFHRKEAD 196
                       689*************************9.999********************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047703.9E-29143195IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.8E-30144194IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.735145194IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257742.0E-24145196IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466891.79E-21290364IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.3E-32294365IPR009057Homeodomain-like
TIGRFAMsTIGR015651.6E-27303359IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009089anatomyendosperm
PO:0007042developmental stagewhole plant fruit formation stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 418 aa     Download sequence    Send to blast
MVSILQLQTR TEASPASSAS AAATRIFAVR RQQQEQEGEE EEEEFEFQER MDLSGAQGEL  60
PIPMHASAAA SPFAGMGAHG GAGGGHVVEL HRHEHVGNNG QAMAMASPPP TNVAVAAEQE  120
GSPVAGKKRG GMAVVGGGGG VAVKYRECLK NHAAAIGGNA TDGCGEFMPS GEEGSLEALK  180
CSACGCHRNF HRKEADDLDA DSCAAALRAA AGRHHHLLGP ALPHHHHKNG GGLLVAGGDP  240
YGAAYAAARA LPPPPPPPPH GHHHHHQIIM PLNMIHTSES DEMDVSGGGG GVGRGGGSSS  300
SSKKRFRTKF TAEQKARMLE FAERVGWRLQ KLDDAMVHHF CQEIGVKRRV LKVWMHNNKH  360
NLAKKPLPSS PPPPPQIPPM SMPPSPPPPQ IPPMSMPPSP PPMPMPMPPS PPQLKLE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A5e-253023611675ZF-HD homeobox family protein
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.762210.0callus| panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1567643290.0
Expression AtlasQ53N87-
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os11g13930.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs11g13930
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1354600.0AC135460.3 Oryza sativa Japonica Group cultivar Nipponbare chromosome 11 clone OSJNBb0091I11, complete sequence.
GenBankAP0149670.0AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
GenBankAK2877140.0AK287714.1 Oryza sativa Japonica Group cDNA, clone: J065133O18, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015616191.10.0PREDICTED: zinc-finger homeodomain protein 4, partial
SwissprotQ53N870.0ZHD4_ORYSJ; Zinc-finger homeodomain protein 4
TrEMBLA0A0E0J0641e-174A0A0E0J064_ORYNI; Uncharacterized protein
STRINGLOC_Os11g13930.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9116237
MonocotsOGMP81535145
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.21e-26homeobox protein 31
Publications ? help Back to Top
  1. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]
  2. Hu W,dePamphilis CW,Ma H
    Phylogenetic analysis of the plant-specific zinc finger-homeobox and mini zinc finger gene families.
    J Integr Plant Biol, 2008. 50(8): p. 1031-45
    [PMID:18713354]