PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os11g12490.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family FAR1
Protein Properties Length: 1319aa    MW: 146992 Da    PI: 5.9705
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os11g12490.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR139.61.7e-12670716147
              FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkk 47 
                       +fYn YA++vGFs++k+++++s++++ +t++tf+C++ g ++   +k
  LOC_Os11g12490.1 670 DFYNGYAYMVGFSTCKASNYHSRKTDVVTRHTFKCNRGGLSAVPYTK 716
                       6**************************************98766555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF565748.9E-8724417IPR023796Serpin domain
Gene3DG3DSA:3.30.497.103.3E-5629193No hitNo description
PfamPF000797.9E-8130417IPR023796Serpin domain
SMARTSM000933.0E-5534417IPR023796Serpin domain
Gene3DG3DSA:2.30.39.102.0E-34194306No hitNo description
Gene3DG3DSA:3.30.497.103.3E-56307366No hitNo description
Gene3DG3DSA:2.30.39.102.0E-34367417No hitNo description
PfamPF031011.5E-10670716IPR004330FAR1 DNA binding domain
PfamPF105515.7E-33784878IPR018289MULE transposase domain
PROSITE profilePS509669.85410691105IPR007527Zinc finger, SWIM-type
PfamPF044341.5E-410711105IPR007527Zinc finger, SWIM-type
SMARTSM005759.1E-610801107IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 1319 aa     Download sequence    Send to blast
MASKTKASKR SRHDHGFAAV ARPPSCPGLT ELAIRLARRI PASAAGGGGN LVFSPLSVYA  60
ALALVAAGAA GDTLAELLGV LGVASYDELA GLVGRLAGKA LADLSGTGGP CVSFVSAVWH  120
DMARTLAPSF RAAAVLSFMA ETHAVDMRSR REAVGQINAW AKKATNELID SVIDGELPAD  180
ADVVVTNAVY FKGKWEEPFK KRLTITDKFH RLGAAAAVDA RFMRSTLPRH HIACHDGFKV  240
LRLPYEQGRR PPWSPPPSRF SMCVFLPDAR DGLWDLLDEI ASAPGLLQAA LPTKTVRVGK  300
FMLPKFKLTF SDDIAGVLRG LGLDVTFSDG VADFSKMVED DGGRRPLSMR SLVHKAVIEV  360
NEEGTEAAAV TGATLCLASA KRPRPVVVDF VADHPFAFFV IEETSGAVVF AGHVLDPSSK  420
PGALDDDDDD DVVDHRSTPG ASEEEDDGDD DMDYHVGMIG CLRQLWGCCC MPFVVGTETE  480
SNEDYGMLFR LSQEGGITYT NLIQQVSVSP NAILPGAEVA GGLPLLQNTY GSFMQLLQAT  540
IESEKSSADV DNQAEMCRPT VQLKASSVEV IYNEMQTQTI EADACFDQHF EQATEEDLLS  600
DHAIVTFQQV EEIEQDKSAE NLDKNFSEED INIFLENESV AVVQRGGQDA NSAHVPSINK  660
VFADENEAFD FYNGYAYMVG FSTCKASNYH SRKTDVVTRH TFKCNRGGLS AVPYTKKTVG  720
NYRDFVRRES GKNDMMQCLD FFEKKRSEDP LFYFRFRTDE NNVVKSLFWS DGNNRKFYEM  780
FDDIVSFDTM YKTNRYDLPF APFVGITSHG DNCLFGYAFL QDETSETFQW LFKTFLDCMG  840
GKVPATIITD QDLAMKAAIA IVFPDTVHRN CLFHMLSNAR DKTGRTFNSE DEEVYKDFHD  900
IVTKSQTEAE FEYLWKDLIR RNNLYNVRYF QLMWVTRKRW ALVYFKSNWC PLIQTTARSE  960
GTNSRYKADI CSSHSVSAFL AQYERIAKTI YECFKEQESL TRNTVLDAWS EYQFEKQAAK  1020
LYIRKIFWAF QRILQSYTKY DVTVNVRDSI FEVYKSEIHA LQDFRKRKYI VFVDTISEEY  1080
ECICSRFKKD GILCVHVLKV LIHLNITKLP EKYFIERWRL KDKNQELSVP NTLMSATVLE  1140
SNPLLRFNIL SQKMIKLASD ASKTKEKFIY VMNESDKIED GLKAMSDTAP NEATVHVQDA  1200
AATTCGVASV GAQTGTLMGP SGVGIDAEST KGAVAEIETT DMVGIASTSV LLDPKCSNSK  1260
GRHKSEPRKK RLINVIRSKG LVTCSGCGSH DHNIRTCPKK QEKPNATEVM KERKSREL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3le2_A3e-783141714391Serpin-ZX
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1380384KRPRP
212611270RHKSEPRKKR
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ53MC8
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os11g12490.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs11g12490
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1369710.0AC136971.3 Oryza sativa Japonica Group cultivar Nipponbare chromosome 11 clone OSJNBa0032K12, complete sequence.
GenBankAP0149670.0AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015642362.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 7-like
TrEMBLQ53MC80.0Q53MC8_ORYSJ; Transposon protein, putative, unclassified
STRINGLOC_Os11g12490.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.12e-64FAR1-related sequence 5
Publications ? help Back to Top
  1. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]