PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os11g11100.1
Common NameLOC4350088, Os11g0218000, OSNPB_110218000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family bZIP
Protein Properties Length: 365aa    MW: 40242.6 Da    PI: 9.8858
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os11g11100.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_121.55.1e-072322771762
                       HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1  17 ArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                       A+rsR RK+++i+eLe+kv++L++e  +   e+e l+++   l+ e
  LOC_Os11g11100.1 232 AQRSRVRKLQYIAELERKVQALQSEGIDVSAEMEFLSQQNIMLDLE 277
                       89***********************999999999888887666655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.3E-5221280IPR004827Basic-leucine zipper domain
CDDcd147033.43E-15222272No hitNo description
SuperFamilySSF579596.88E-6231274No hitNo description
Gene3DG3DSA:1.20.5.1704.7E-7232274No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MMMANAKLPK QALLPPRSPF PTAAAAAGPY AGDHGPIARP QGAPHHRHGH GHGHHQRTSS  60
ESFIEEQPSW LDDLLNEPET PVRQHGRAGH RRSSSDSFAM FDGGAAAGAY ANGFEGMGGG  120
GGGGQAAPWG GVQEYYAKPS SFGRHQGRPW EQGMNNLVNY RQSGGPPMPA KEKVGGHHGS  180
PSVLRDHDHG MDRRSSDESG HDQKVGPERK EGVPPKHAQS EADTKRAKQQ YAQRSRVRKL  240
QYIAELERKV QALQSEGIDV SAEMEFLSQQ NIMLDLENKA LKQRLESLAQ EQLIKRFQQE  300
MFEREIGRLR SLYQQQQQQQ KQPQPTTTLS RSNSRDLDSQ FANLSLKHKD PNSGPLRTQS  360
SSIL*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.231070.0callus| flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329822900.0
Expression AtlasQ2R8T2-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os11g11100.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs11g11100
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0722670.0AK072267.1 Oryza sativa Japonica Group cDNA clone:J023004I18, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015617316.10.0PREDICTED: uncharacterized protein At4g06598
TrEMBLA0A0E0IZQ50.0A0A0E0IZQ5_ORYNI; Uncharacterized protein
TrEMBLA0A0E0R5W50.0A0A0E0R5W5_ORYRU; Uncharacterized protein
TrEMBLQ2R8T20.0Q2R8T2_ORYSJ; BZIP transcription factor family protein, expressed
STRINGLOC_Os11g11100.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP42521219
MonocotsOGMP33103666
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G58110.25e-57bZIP family protein
Publications ? help Back to Top
  1. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]