PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os11g10130.1
Common NameLOC4350036, Os11g0207600, OSNPB_110207600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 268aa    MW: 28815 Da    PI: 10.4098
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os11g10130.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.52.6e-172671147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                      rg W + Ede+l ++v+++G+ +W++Ia+++  gR++k+c++rw++ 
  LOC_Os11g10130.1 26 RGHWRPGEDEKLRQLVEKYGPQNWNSIAEKLE-GRSGKSCRLRWFNQ 71
                      899*****************************.***********996 PP

2Myb_DNA-binding62.58.7e-2079122247
                       SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        ++T+eE+e+l+ a++ +G++ W++Iar+++ gRt++ +k++w+ +
  LOC_Os11g10130.1  79 RPFTEEEEERLLAAHRHHGNK-WALIARHFP-GRTDNAVKNHWHVV 122
                       69*******************.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.6622172IPR017930Myb domain
SMARTSM007172.1E-142574IPR001005SANT/Myb domain
SuperFamilySSF466893.67E-3025119IPR009057Homeodomain-like
PfamPF002498.0E-172671IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.2E-272779IPR009057Homeodomain-like
CDDcd001671.47E-142970No hitNo description
PROSITE profilePS5129428.91873127IPR017930Myb domain
SMARTSM007171.3E-1677125IPR001005SANT/Myb domain
PfamPF002497.8E-1778121IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.1E-2280122IPR009057Homeodomain-like
CDDcd001678.26E-989120No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009072anatomyplant ovary
PO:0007042developmental stagewhole plant fruit formation stage
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MASSSTTNTS DGAGKPASSS SSACPRGHWR PGEDEKLRQL VEKYGPQNWN SIAEKLEGRS  60
GKSCRLRWFN QLDPRINKRP FTEEEEERLL AAHRHHGNKW ALIARHFPGR TDNAVKNHWH  120
VVRARRSRER SRLLARAAAA AAHPPPFSSY ASQLDFSGGG ASSGARNSSL CFGFGMINRS  180
SSSSSSPAAA PFLIKSFNGT SYGTLLPATT SMAAAAQPVS TITFSSTPMR ETLELMDAGG  240
HENHGDVDGG GDKRKGVPYF DFLGVGV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C2e-3026119497C-Myb DNA-Binding Domain
1msf_C2e-3026119497C-Myb DNA-Binding Domain
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.1004100.0root
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ2R933
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os11g10130.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs11g10130
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1722820.0AF172282.1 Oryza sativa adh1-adh2 region.
GenBankCP0126190.0CP012619.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 11 sequence.
GenBankAC1235230.0AC123523.2 Oryza sativa (japonica cultivar-group) chromosome 11 clone OSJNBa0051P13, complete sequence.
GenBankAP0149670.0AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015615875.10.0PREDICTED: transcription factor MYB44
TrEMBLA2ZCG80.0A2ZCG8_ORYSI; Putative uncharacterized protein
TrEMBLA0A0E0IZF70.0A0A0E0IZF7_ORYNI; Uncharacterized protein
TrEMBLQ9LLM90.0Q9LLM9_ORYSA; Myb-like protein
TrEMBLQ2R9330.0Q2R933_ORYSJ; Myb-like DNA-binding domain containing protein, expressed
STRINGBGIOSGA034994-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os11g10130.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP29438260
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.13e-49myb domain protein 52
Publications ? help Back to Top
  1. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]