PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os11g09160.2
Common NameOsJ_33271
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family B3
Protein Properties Length: 366aa    MW: 41192.6 Da    PI: 9.6081
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os11g09160.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B355.69.9e-183801598
                      -EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
                B3 15 rlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98
                      r+ +p +f  ++ ++++++  +++l d+sg++W+ +l  +  s+++++  GWkeFv++n ++ g f+vF++d+rs+f   v+vf+
  LOC_Os11g09160.2  3 RMKIPSSFN-QClQNQPTG--MVSLVDRSGNKWSAEL--TSDSEGFFFVHGWKEFVRDNSIQCGQFLVFTYDKRSQF--SVTVFE 80
                      899*****8.554766665..8***************..*********************************99999..888876 PP

2B352.68e-17259350398
                       EE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
                B3   3 kvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                       ++++ s+v     + +p +f++e+   ++++k +tl d++g+ Wev++ y   ++   +++GW +F+  n+L+  D++vF+l+++++   +v+
  LOC_Os11g09160.2 259 QIMMESYVYVGFFMNIPCEFVRECL--PHTNKRITLWDPQGKAWEVNYVYYSDRSVGSFSGGWGKFAVGNNLEKFDVCVFELVQKDN--IKVH 347
                       6789999999**************5..335568***************995555556799*********************998444..5788 PP

                       EE- CS
                B3  96 vfr 98 
                       ++r
  LOC_Os11g09160.2 348 IYR 350
                       876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086315.933182IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.5E-19382IPR015300DNA-binding pseudobarrel domain
CDDcd100172.50E-16379No hitNo description
SMARTSM010195.7E-7382IPR003340B3 DNA binding domain
PfamPF023627.8E-16379IPR003340B3 DNA binding domain
SuperFamilySSF1019365.36E-21386IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.104.7E-26249350IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019367.98E-26250350IPR015300DNA-binding pseudobarrel domain
CDDcd100176.37E-24255350No hitNo description
SMARTSM010194.6E-15257352IPR003340B3 DNA binding domain
PROSITE profilePS5086313.225257352IPR003340B3 DNA binding domain
PfamPF023626.8E-15259350IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MERMKIPSSF NQCLQNQPTG MVSLVDRSGN KWSAELTSDS EGFFFVHGWK EFVRDNSIQC  60
GQFLVFTYDK RSQFSVTVFE PSGIDKISTF SAHPSKNVII KTESDEGGMV TAAITTEKMA  120
PALKENNGIT GKRTRDVDYL MEDRVVVFKK SSEANVCESS RRKRAGASAG KSKVTSTSHN  180
STRGSSCSSD EDNSSSKSPN PPFLMRFLSG EVSRRGRCVS KGQRQLTVIS QRRPVTEAEK  240
DHALQRAREF KSKNPFAVQI MMESYVYVGF FMNIPCEFVR ECLPHTNKRI TLWDPQGKAW  300
EVNYVYYSDR SVGSFSGGWG KFAVGNNLEK FDVCVFELVQ KDNIKVHIYR VVPEITPHKL  360
RSDPK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A8e-1423035122142B3 domain-containing transcription factor VRN
4i1k_B8e-1423035122142B3 domain-containing transcription factor VRN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.525080.0callus| panicle| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329775890.0
Expression AtlasB9G9U8-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os11g09160.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs11g09160
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1019410.0AK101941.1 Oryza sativa Japonica Group cDNA clone:J033074I03, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015615373.10.0PREDICTED: B3 domain-containing protein Os11g0197600
SwissprotQ2R9D20.0Y1176_ORYSJ; B3 domain-containing protein Os11g0197600
TrEMBLB9G9U80.0B9G9U8_ORYSJ; Uncharacterized protein
STRINGLOC_Os11g09160.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42700.11e-17B3 family protein