PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os11g09160.1
Common NameLOC4349997, Os11g0197600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family B3
Protein Properties Length: 407aa    MW: 45776.1 Da    PI: 9.9342
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os11g09160.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B358.21.4e-1832121198
                       EEEE-..-HHHHTT-EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE.. CS
                B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefel 92 
                       ff vl++    ++ r+ +p +f  ++ ++++++  +++l d+sg++W+ +l  +  s+++++  GWkeFv++n ++ g f+vF++d+rs+f  
  LOC_Os11g09160.1  32 FFRVLLT--LQSLERMKIPSSFN-QClQNQPTG--MVSLVDRSGNKWSAEL--TSDSEGFFFVHGWKEFVRDNSIQCGQFLVFTYDKRSQF-- 115
                       5666633..4456679******8.564767666..8***************..*********************************99999.. PP

                       EEEEE- CS
                B3  93 vvkvfr 98 
                        v+vf+
  LOC_Os11g09160.1 116 SVTVFE 121
                       888876 PP

2B352.49.7e-17300391398
                       EE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
                B3   3 kvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                       ++++ s+v     + +p +f++e+   ++++k +tl d++g+ Wev++ y   ++   +++GW +F+  n+L+  D++vF+l+++++   +v+
  LOC_Os11g09160.1 300 QIMMESYVYVGFFMNIPCEFVRECL--PHTNKRITLWDPQGKAWEVNYVYYSDRSVGSFSGGWGKFAVGNNLEKFDVCVFELVQKDN--IKVH 388
                       6789999999**************5..335568***************995555556799*********************998444..5788 PP

                       EE- CS
                B3  96 vfr 98 
                       ++r
  LOC_Os11g09160.1 389 IYR 391
                       776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd100171.02E-1730120No hitNo description
PROSITE profilePS5086314.77630123IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.105.9E-2131123IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.75E-2231127IPR015300DNA-binding pseudobarrel domain
SMARTSM010198.1E-1532123IPR003340B3 DNA binding domain
PfamPF023621.5E-1639120IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.105.8E-26290391IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019369.81E-26291391IPR015300DNA-binding pseudobarrel domain
CDDcd100171.68E-23296391No hitNo description
PROSITE profilePS5086313.225298393IPR003340B3 DNA binding domain
SMARTSM010194.6E-15298393IPR003340B3 DNA binding domain
PfamPF023628.2E-15300391IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020104anatomyleaf sheath
Sequence ? help Back to Top
Protein Sequence    Length: 407 aa     Download sequence    Send to blast
MVVREKQGGR MGKGKGKGKE KECDINCFGR SFFRVLLTLQ SLERMKIPSS FNQCLQNQPT  60
GMVSLVDRSG NKWSAELTSD SEGFFFVHGW KEFVRDNSIQ CGQFLVFTYD KRSQFSVTVF  120
EPSGIDKIST FSAHPSKNVI IKTESDEGGM VTAAITTEKM APALKENNGI TGKRTRDVDY  180
LMEDRVVVFK KSSEANVCES SRRKRAGASA GKSKVTSTSH NSTRGSSCSS DEDNSSSKSP  240
NPPFLMRFLS GEVSRRGRCV SKGQRQLTVI SQRRPVTEAE KDHALQRARE FKSKNPFAVQ  300
IMMESYVYVG FFMNIPCEFV RECLPHTNKR ITLWDPQGKA WEVNYVYYSD RSVGSFSGGW  360
GKFAVGNNLE KFDVCVFELV QKDNIKVHIY RVVPEITPHK LRSDPK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A1e-1327139222142B3 domain-containing transcription factor VRN
4i1k_B1e-1327139222142B3 domain-containing transcription factor VRN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.525080.0callus| panicle| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329775890.0
Expression AtlasQ2R9D2-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os11g09160.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs11g09160
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1019410.0AK101941.1 Oryza sativa Japonica Group cDNA clone:J033074I03, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015615373.10.0PREDICTED: B3 domain-containing protein Os11g0197600
SwissprotQ2R9D20.0Y1176_ORYSJ; B3 domain-containing protein Os11g0197600
TrEMBLB8BJK10.0B8BJK1_ORYSI; Putative uncharacterized protein
STRINGLOC_Os11g09160.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP20511436
MonocotsOGMP44613766
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42700.12e-17B3 family protein
Publications ? help Back to Top
  1. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]