PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os11g08410.1
Common NameOs11g0187200, OSNPB_110187200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GATA
Protein Properties Length: 432aa    MW: 44556.5 Da    PI: 7.2137
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os11g08410.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA58.21.1e-18363396134
              GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                       Cs+Cgt++Tp+WR gpdg+ tLCnaCG++ +  +
  LOC_Os11g08410.1 363 CSHCGTSETPQWRMGPDGPGTLCNACGIRSKMDR 396
                       *****************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004014.7E-17357407IPR000679Zinc finger, GATA-type
PROSITE profilePS5011413.231357395IPR000679Zinc finger, GATA-type
SuperFamilySSF577164.13E-14359420No hitNo description
Gene3DG3DSA:3.30.50.102.0E-15361396IPR013088Zinc finger, NHR/GATA-type
CDDcd002024.64E-16362418No hitNo description
PROSITE patternPS003440363388IPR000679Zinc finger, GATA-type
PfamPF003201.7E-16363397IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0030154Biological Processcell differentiation
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 432 aa     Download sequence    Send to blast
MPKPTPSSSS FLDFTGGVDG DDDDPSCPFE GLCCPDDPLD QVLNFDSSDF GHVFFESLDV  60
ELFLPRGGPS RGAGEEDSKG AVERVAFGSS AAVESELGGV GGGGAGSEVS VPGGAGGGRG  120
EDMETEALDV KPVVGVGAGG AMGAHVAGGV GAPGAFPESK QLVPWPCAVG AGASAPGAAP  180
DNRLLALPDV RFDALTAEGA APGGERGKTI PDSVSKNGLP TLPGVRSATP TAPPATPFRL  240
EWDHAAAPSS SATTTPSDSS LSSPPSLSSV FPRIARVFPS RTKPRRRRTL RRQHWSLICP  300
LHLVPVAAAA DAARGKSISE LNASASAATD AGTPSINDGG GGSYHRRVVG RQRNRQVRKD  360
RRCSHCGTSE TPQWRMGPDG PGTLCNACGI RSKMDRLLPE YRPSTSPSFN GDEHSNRHRK  420
VLKLREKKGR D*
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ53P56
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os11g08410.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs11g08410
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1286440.0AC128644.4 Oryza sativa Japonica Group cultivar Nipponbare chromosome 11 clone OSJNBb0009F15, complete sequence.
GenBankAP0149670.0AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLQ53P560.0Q53P56_ORYSJ; GATA zinc finger family protein
STRINGLOC_Os11g08410.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6817287
MonocotsOGMP127772434
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36240.14e-26GATA transcription factor 7
Publications ? help Back to Top
  1. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]