PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os11g08210.1
Common NameLOC4349963, NAC71, Os11g0184900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NAC
Protein Properties Length: 330aa    MW: 35522.8 Da    PI: 5.4489
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os11g08210.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.76.7e-5191331128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                       lppGfrFhPtd+elv++yL++k+ g +l +  vi+evd+yk++PwdLp+++ ++ekewyfFs+rd+ky++g+r+nra+ +gyWkatg dk+v 
  LOC_Os11g08210.1   9 LPPGFRFHPTDDELVMYYLCRKCGGLPLAA-PVIAEVDLYKFNPWDLPERAMGGEKEWYFFSPRDRKYPNGQRPNRAAGTGYWKATGADKPVG 100
                       79*************************999.89***************8888999*************************************9 PP

               NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       s   ++v +kk Lvfy g+ pkg+kt+W+mheyrl
  LOC_Os11g08210.1 101 S--PRAVAIKKALVFYAGKPPKGVKTNWIMHEYRL 133
                       9..678***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.67E-615166IPR003441NAC domain
PROSITE profilePS5100558.6669166IPR003441NAC domain
PfamPF023659.6E-2610133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MECGGALQLP PGFRFHPTDD ELVMYYLCRK CGGLPLAAPV IAEVDLYKFN PWDLPERAMG  60
GEKEWYFFSP RDRKYPNGQR PNRAAGTGYW KATGADKPVG SPRAVAIKKA LVFYAGKPPK  120
GVKTNWIMHE YRLADVDRSA AARKLSKSSH NALRLDDWVL CRIYNKKGVI ERYDTVDAGE  180
DVKPAAAAAA AKGGRIGGGG GAAAMKVELS DYGFYDQEPE SEMLCFDRSG SADRDSMPRL  240
HTDSSGSEHV LSPSPSPDDF PGGGDHDYAE SQPSGGCGGW PGVDWAAVGD DGFVIDSSLF  300
ELPSPAAFSR AAGDGAAFGD MFTYLQKPF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A7e-77717213174Stress-induced transcription factor NAC1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1192200GGRIGGGGG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.519260.0callus| flower| leaf| panicle| root| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1154845140.0
Expression AtlasQ53NF7-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots and embryo. Weakly expressed in callus. {ECO:0000269|PubMed:10660065}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os11g08210.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs11g08210
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0281840.0AB028184.1 Oryza sativa mRNA for OsNAC5 protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015617286.10.0PREDICTED: NAC domain-containing protein 71
SwissprotQ53NF70.0NAC71_ORYSJ; NAC domain-containing protein 71
TrEMBLA0A0D3HJ090.0A0A0D3HJ09_9ORYZ; Uncharacterized protein
TrEMBLI1QYA80.0I1QYA8_ORYGL; Uncharacterized protein
TrEMBLA0A0E0BG510.0A0A0E0BG51_9ORYZ; Uncharacterized protein
STRINGLOC_Os11g08210.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MonocotsOGMP118043039
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77450.11e-91NAC domain containing protein 32
Publications ? help Back to Top
  1. Kikuchi K, et al.
    Molecular analysis of the NAC gene family in rice.
    Mol. Gen. Genet., 2000. 262(6): p. 1047-51
    [PMID:10660065]
  2. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]
  3. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]