PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os11g06180.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GRAS
Protein Properties Length: 473aa    MW: 52312.6 Da    PI: 4.537
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os11g06180.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS1832.2e-56483912354
              GRAS   2 velLlecAeavssgdlelaqalLarlsel.....aspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsP 89 
                        +lLl+ Aeav++gd  la+ + +rl +       + +++++ Rla +f ++L++r+++ ++++y+   p++ +    s ++ ++++ +e+sP
  LOC_Os11g06180.1  48 SDLLLAGAEAVEAGDSILASVAFSRLDDFlsgipENGAASSFDRLAYHFDQGLRSRMSSASTGCYQ---PEPLP----SGNMLVHQIIQELSP 133
                       679***********************998554333334479******************9899984...55554....456778899****** PP

              GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlv 182
                       ++kf+h+t+NqaIl+a+ g+  vH++D++i++G+QW +L+  La    g  s+R+T++   +  ++ +  ++ + L++fA++l++pf++n + 
  LOC_Os11g06180.1 134 FVKFAHFTTNQAILDAIIGDMDVHVVDLNIGEGIQWSSLMSDLAR--CGGKSFRLTAITTYADCHASTHDTVVRLLSEFADSLELPFQYNSIC 224
                       ********************************************7..4668*********887799999999999****************87 PP

              GRAS 183 akrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqe.......adhnsesFlerflealeyysalf 268
                       +++ ++l  +++  + + +++V++    ++    s+s+ +  + +L +vk+l+Pk+vv +e++       ++ +s+sF+e f+eal++++++f
  LOC_Os11g06180.1 225 VHNEDEL--HAFFEDCKGSVIVSCDTTSMYYK--SLSTLQ--SLLLVCVKKLQPKLVVTIEEDlvrigrgVSPSSASFVEFFFEALHHFTTVF 311
                       7765555..777777799******99777775..554444..69*******************6555443444666***************** PP

              GRAS 269 dsleaklpres..eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveee 354
                       +s+++ +   s     + vE ellg++i++ v + g+ r+e +      +e l   GF + +ls  + +qa++l+  ++ + + v  +
  LOC_Os11g06180.1 312 ESMASCFIGSSyePCLRLVEMELLGPRIQDFVVKYGSVRVEANA-----SEVL--EGFMACELSACNIAQARMLVGLFN-RVFGVVFK 391
                       ***77776666578899*********************999888.....5555..5********************999.44555544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098530.45521392IPR005202Transcription factor GRAS
PfamPF035147.5E-5448391IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 473 aa     Download sequence    Send to blast
MVLDSNELHQ HDAPDVDVSI NCDDRIFGQE SVNLAAIQEE LLEEDSLSDL LLAGAEAVEA  60
GDSILASVAF SRLDDFLSGI PENGAASSFD RLAYHFDQGL RSRMSSASTG CYQPEPLPSG  120
NMLVHQIIQE LSPFVKFAHF TTNQAILDAI IGDMDVHVVD LNIGEGIQWS SLMSDLARCG  180
GKSFRLTAIT TYADCHASTH DTVVRLLSEF ADSLELPFQY NSICVHNEDE LHAFFEDCKG  240
SVIVSCDTTS MYYKSLSTLQ SLLLVCVKKL QPKLVVTIEE DLVRIGRGVS PSSASFVEFF  300
FEALHHFTTV FESMASCFIG SSYEPCLRLV EMELLGPRIQ DFVVKYGSVR VEANASEVLE  360
GFMACELSAC NIAQARMLVG LFNRVFGVVF KKISLLMVYY ISLGKNDLRE PNKVIWSSLA  420
AGCGSHGIVV LAFYAADKLL EFKPKGIETY IHPAVERAHF HKEDRMWQEY EN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-169037941340GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.933822e-79stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329704782e-79
Expression AtlasQ53PL9-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os11g06180.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs11g06180
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126190.0CP012619.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 11 sequence.
GenBankAC1205340.0AC120534.5 Oryza sativa Japonica Group cultivar Nipponbare chromosome 11 clone OSJNBa0084A20, complete sequence.
GenBankAP0149670.0AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015617104.10.0PREDICTED: nodulation-signaling pathway 2 protein
TrEMBLI1QXX40.0I1QXX4_ORYGL; Uncharacterized protein
TrEMBLQ53PL90.0Q53PL9_ORYSJ; GRAS family transcription factor containing protein
STRINGLOC_Os11g06180.10.0(Oryza sativa Japonica Group)
STRINGORGLA11G0036600.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP8945915
MonocotsOGMP76843250
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08250.16e-29GRAS family protein
Publications ? help Back to Top
  1. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]