PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os11g06020.1
Common NameLOC4349837, Os11g0158600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family TALE
Protein Properties Length: 679aa    MW: 69897.7 Da    PI: 6.6691
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os11g06020.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.92e-093824191954
                       HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
          Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                       Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  LOC_Os11g06020.1 382 FEHflHPYPKDSDKIMLAKQTGLTRSQVSNWFINARVR 419
                       664459******************************88 PP

2BELL118.33.6e-38243314172
              BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                       erqelq+kk kL+++l+eV++rY+qy++q+q+v++sFeavag gsa+ Yt+lAl++iSr+FrcL+daia+q+
  LOC_Os11g06020.1 243 ERQELQMKKGKLINMLDEVEQRYRQYHQQMQVVVASFEAVAGGGSARTYTALALRTISRQFRCLRDAIAGQV 314
                       79*******************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.1E-61161312IPR006563POX domain
PfamPF075264.2E-50169311IPR006563POX domain
PROSITE profilePS5007112.228360423IPR001356Homeobox domain
CDDcd000863.73E-13363424No hitNo description
SMARTSM003891.2E-9363427IPR001356Homeobox domain
SuperFamilySSF466893.59E-17364430IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.9E-29366429IPR009057Homeodomain-like
PfamPF059202.6E-18380419IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009610Biological Processresponse to symbiotic fungus
GO:0009737Biological Processresponse to abscisic acid
GO:0010197Biological Processpolar nucleus fusion
GO:0010201Biological Processresponse to continuous far red light stimulus by the high-irradiance response system
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0046982Molecular Functionprotein heterodimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 679 aa     Download sequence    Send to blast
MAAYYHGGAG TDIQSGTDGL QTLYLMNPSY AGYGDAAAAA AAPGAAANMM LLNSAVTSMT  60
PVSFGHQPSP SSSSAAQHFV GIPLQAPPAS GYNLWTPAAA TGAGDMSPPT PQHQHQQAHG  120
GGAAGVSAVL SLSSREAAPP VTVAAVVAAG DEGKYLQAVA QGAASHGQMV MSSKYLKAAQ  180
ELLDEVVSVS KGVDDVKAAA AAKSPASVKK KEDSEGVSGG GTEDGGGAKS GGAPPPPEMS  240
TAERQELQMK KGKLINMLDE VEQRYRQYHQ QMQVVVASFE AVAGGGSART YTALALRTIS  300
RQFRCLRDAI AGQVRAASRA LGEAVDADGG CGRTVGSRLR YIDHQLRQQR ALQQLGMMQS  360
SAWRPQRGLP ERSVSILRAW LFEHFLHPYP KDSDKIMLAK QTGLTRSQVS NWFINARVRL  420
WKPMVEEMYL EETKDQDGGG GAGAGDEGSK PGGSKGGGAG VNGGVVDSAA KMDSKAAHME  480
SGGGVHPSLL ELAGDHQAQA GFYDDDDEDG GAAAALQQKL KKARTEEQQQ AAFHVSDVAT  540
LHAHAAAAAA ARHDEVSHRE LLMKFMESGS AGAGAGAAAR DHHHEHHGGV GYSLFAPAPY  600
GQFATEQFAF AGHGGGGGGG GVSLTLGLPH GAEQTASFLM TSSNGSDGAG HVAGGGGYDM  660
NMQSTKSFAA QLMRDFVA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrm_A2e-17369427563Homeobox protein Meis2
4xrm_B2e-17369427563Homeobox protein Meis2
5bng_A2e-17369427159Homeobox protein Meis2
5bng_B2e-17369427159Homeobox protein Meis2
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.118050.0leaf| panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2976112750.0
Expression AtlasQ2RAA7-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os11g06020.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs11g06020
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126190.0CP012619.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 11 sequence.
GenBankAC1332170.0AC133217.2 Oryza sativa (japonica cultivar-group) chromosome 11 BAC clone OSJNBa0052H02, complete sequence.
GenBankAP0149670.0AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015616922.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_015616923.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_015616924.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_015616925.10.0PREDICTED: BEL1-like homeodomain protein 1
SwissprotQ9SJ561e-114BLH1_ARATH; BEL1-like homeodomain protein 1
TrEMBLB8BJ810.0B8BJ81_ORYSI; Putative uncharacterized protein
TrEMBLQ2RAA70.0Q2RAA7_ORYSJ; Associated with HOX family protein, expressed
STRINGBGIOSGA034459-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os11g06020.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP13316172
MonocotsOGMP48163758
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.36e-90BEL1-like homeodomain 1
Publications ? help Back to Top
  1. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]