PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os11g05640.1
Common NameLOC4349815, Os11g0154900, OSNPB_110154900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family bZIP
Protein Properties Length: 395aa    MW: 41204 Da    PI: 6.6304
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os11g05640.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.73.4e-10124186163
                       XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                       eke kr rr   NRe+Ar   +R++a  +eL++kv+ L+++N+++kke +   +e+ +lk  +
  LOC_Os11g05640.1 124 EKEAKRLRRVLANRESARQTILRRQAIRDELARKVADLSSQNETMKKEKDVVMQEYLSLKETN 186
                       89*********************************************************9877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.2E-12124188IPR004827Basic-leucine zipper domain
PfamPF001705.1E-9124186IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.979126189IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.6E-5128192No hitNo description
SuperFamilySSF579598.84E-7128184No hitNo description
CDDcd147022.54E-13129179No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 395 aa     Download sequence    Send to blast
MSDHSSSDGQ RQCRRRGVGV DVELDAAMAL ADMAGAAPGQ PEASPPPHAT QEAAAAAVAK  60
GEQEDEAEMA STRLSLELGK VGIQSSPPCS SSSSAGHPAM QPAAAATAAP GYGPRPRHML  120
TEAEKEAKRL RRVLANRESA RQTILRRQAI RDELARKVAD LSSQNETMKK EKDVVMQEYL  180
SLKETNKQLK EQVAIRTIKK AAVAEPMDTA PPAQQQAETA AAVAPPTTAT PPSTAPQPSF  240
LYTAAPAGVA PVPYVWGSWP PCGPTGYEPP PPLCLPPCAW YYPVVADPRV SSPPTSTYPQ  300
SYQEQPTSSP GGGTAEEDTD DDPCSLTLAI DVDKRSAPGA GGSAAGAGQH ASISDREKAT  360
AAAEARKRRK ELTKLKQMHG GGGGSRPGGG GEHW*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1365370RKRRKE
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1567645200.0
Expression AtlasA0A0N7KSG4-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os11g05640.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs11g05640
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2879050.0AK287905.1 Oryza sativa Japonica Group cDNA, clone: J065211O07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015615785.10.0PREDICTED: translation initiation factor IF-2
TrEMBLA0A0N7KSG40.0A0A0N7KSG4_ORYSJ; Os11g0154900 protein
STRINGLOC_Os11g05640.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP45691318
MonocotsOGMP31653475
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19490.13e-17bZIP family protein
Publications ? help Back to Top
  1. Nantel A,Quatrano RS
    Characterization of three rice basic/leucine zipper factors, including two inhibitors of EmBP-1 DNA binding activity.
    J. Biol. Chem., 1996. 271(49): p. 31296-305
    [PMID:8940135]