PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os11g04590.1
Common NameLOC107276448, OsJ_32921
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GRAS
Protein Properties Length: 461aa    MW: 50420.4 Da    PI: 7.3424
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os11g04590.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS290.74e-89343419374
              GRAS  19 laqalLarlsel..aspdg.dpmqRlaayfteALaarlarsvselykal.ppsetseknsseelaalklfsevsPilkfshltaNqaIleave 107
                       +a+++Lar   l  a+ +g  p +Rla  ++  La+rl+r v+ + +al  ps     +  ++ aa++ f+e+sP++k+++++ N+aI+eave
  LOC_Os11g04590.1   3 KATRCLARATGLaaAAAAGdGPRKRLAVAMVDCLARRLLRPVQAITDALiDPSVYL--DRRSVRAARRGFFELSPFPKVAFVVGNRAIVEAVE 93 
                       6888888888775445555479***********************99995444443..34555578899************************ PP

              GRAS 108 geervHiiDfd..isqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeL... 194
                       +e+ vH++ ++   +q+ QW+ Ll++L  Rpegpp  +R+T+v++    + e l +++e  ++ Aeelg++f+f+  v+ +ledl++++L   
  LOC_Os11g04590.1  94 NESLVHVVGMSgpFTQPCQWIQLLHELRRRPEGPPrVVRLTVVHD----DGELLAKMEELVSDEAEELGMEFQFHG-VVGQLEDLDFSNLrnv 181
                       **********86679****************9988789*******....***************************.7999****99998666 PP

              GRAS 195 .rvkpgEalaVnlvlqlhrll....................................................................desv 218
                        ++k+gEal+V++ lqlhrll                                                                    + ++
  LOC_Os11g04590.1 182 lEIKSGEALVVSCTLQLHRLLaadddamyssrsahlnqmasiaqlqhmavnscpsssgggsvqykdddpyrspatpltfvsppvstphfQTPA 274
                       67889*****************************************************************************99865555555 PP

              GRAS 219 sleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres........eerikvErellgreivnvvacega 303
                       +l     ++L++v+ lsPk++vv+eq+adhn+ sF +rf+eal++y+a+fdsl+a ++++s        +er+ vEr+++g+ei+ v+   ga
  LOC_Os11g04590.1 275 AL----ASFLSAVRALSPKILVVAEQDADHNGVSFRKRFCEALHHYAAVFDSLDAAAATTSaasrlwspDERAQVERVVVGEEIKGVLLRDGA 363
                       55....55*********************************************99988888888999999*********************** PP

              GRAS 304 errerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                       +rre h +l++W +r+e+aGF+ vpls+ a k+ + ++r+++ +  + +e  g+l+l+W++rpL+s+SaWr
  LOC_Os11g04590.1 364 HRREWHDRLRQWAARMEMAGFTGVPLSYAAIKKGNDMVRRCGLRRCENKECGGCLLLCWSSRPLYSISAWR 434
                       ******************************************887999999*******************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098540.411414IPR005202Transcription factor GRAS
PfamPF035141.4E-863434IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 461 aa     Download sequence    Send to blast
MEKATRCLAR ATGLAAAAAA GDGPRKRLAV AMVDCLARRL LRPVQAITDA LIDPSVYLDR  60
RSVRAARRGF FELSPFPKVA FVVGNRAIVE AVENESLVHV VGMSGPFTQP CQWIQLLHEL  120
RRRPEGPPRV VRLTVVHDDG ELLAKMEELV SDEAEELGME FQFHGVVGQL EDLDFSNLRN  180
VLEIKSGEAL VVSCTLQLHR LLAADDDAMY SSRSAHLNQM ASIAQLQHMA VNSCPSSSGG  240
GSVQYKDDDP YRSPATPLTF VSPPVSTPHF QTPAALASFL SAVRALSPKI LVVAEQDADH  300
NGVSFRKRFC EALHHYAAVF DSLDAAAATT SAASRLWSPD ERAQVERVVV GEEIKGVLLR  360
DGAHRREWHD RLRQWAARME MAGFTGVPLS YAAIKKGNDM VRRCGLRRCE NKECGGCLLL  420
CWSSRPLYSI SAWRPAASRG SGSGSERSEY VHVGAEPDDR *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-131543431375GRAS family transcription factor containing p
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ2RAQ6
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os11g04590.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs11g04590
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1514800.0AC151480.1 Oryza sativa (japonica cultivar-group) chromosome 11 clone OSJNAa0068G15, complete sequence.
GenBankAP0149670.0AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015616103.10.0PREDICTED: scarecrow-like protein 3
TrEMBLQ2RAQ60.0Q2RAQ6_ORYSJ; GRAS family transcription factor containing protein
STRINGLOC_Os11g04590.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1542634
MonocotsOGMP60438176
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.12e-66scarecrow-like 3
Publications ? help Back to Top
  1. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]