PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os11g03440.1
Common NameLOC4349657, Os11g0128500, OsJ_32794, OSNPB_110128500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 309aa    MW: 33599.7 Da    PI: 5.8377
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os11g03440.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.26.9e-171461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+eEd +lv +++++G+g+W++++   g+ R+ k+c++rw +yl
  LOC_Os11g03440.1 14 KGPWTPEEDIILVSYIQEHGPGNWRSVPINTGLMRCSKSCRLRWTNYL 61
                      79********************************************97 PP

2Myb_DNA-binding46.58.3e-1567112148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg++T+ E+ ++v++  +lG++ W++Ia++++  Rt++++k++w+++l
  LOC_Os11g03440.1  67 RGNFTAHEEGIIVHLQSLLGNR-WAAIASYLP-QRTDNDIKNYWNTHL 112
                       89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.9E-24564IPR009057Homeodomain-like
PROSITE profilePS5129425.517965IPR017930Myb domain
SuperFamilySSF466897.86E-3011108IPR009057Homeodomain-like
SMARTSM007174.4E-131363IPR001005SANT/Myb domain
PfamPF002491.1E-151461IPR001005SANT/Myb domain
CDDcd001678.37E-121661No hitNo description
Gene3DG3DSA:1.10.10.601.2E-2365116IPR009057Homeodomain-like
SMARTSM007174.1E-1366114IPR001005SANT/Myb domain
PROSITE profilePS5129418.44366116IPR017930Myb domain
PfamPF002491.6E-1267112IPR001005SANT/Myb domain
CDDcd001671.24E-969112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009416Biological Processresponse to light stimulus
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010118Biological Processstomatal movement
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020048anatomymicrospore
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MGRPPCCDKE GIKKGPWTPE EDIILVSYIQ EHGPGNWRSV PINTGLMRCS KSCRLRWTNY  60
LRPGIKRGNF TAHEEGIIVH LQSLLGNRWA AIASYLPQRT DNDIKNYWNT HLKKKLAAAA  120
NSTSAASNRH PIFADATFPS AAGSHTVSSN SDVNQMAAIA RRSPFADCPS SSYASSMDNI  180
SKLLDGFMKT NSPSPPPPPL QHYDGGYYDD VKPAVDVVGN PLLSSFDCMS GADLDCCFDV  240
HQQQPASSFM EYGGYGGGYG DESKQQLMNQ AAAPLSSIEK WLFDEAAAEQ VADLMDLSDG  300
CCSVPMMF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-25141164105MYB PROTO-ONCOGENE PROTEIN
1h8a_C2e-251211625128MYB TRANSFORMING PROTEIN
1mse_C2e-25141164105C-Myb DNA-Binding Domain
1msf_C2e-25141164105C-Myb DNA-Binding Domain
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.848160.0leaf
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2976111480.0
Expression AtlasQ2RB26-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00132DAPTransfer from AT1G08810Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os11g03440.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs11g03440
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2415490.0AK241549.1 Oryza sativa Japonica Group cDNA, clone: J065176M15, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015616542.10.0PREDICTED: myb-related protein 306
SwissprotP813924e-81MYB06_ANTMA; Myb-related protein 306
TrEMBLA2ZB040.0A2ZB04_ORYSI; Putative uncharacterized protein
TrEMBLQ2RB260.0Q2RB26_ORYSJ; Myb-like DNA-binding domain containing protein, expressed
STRINGBGIOSGA034582-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os11g03440.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP22938296
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08810.13e-80myb domain protein 60
Publications ? help Back to Top
  1. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]