PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os11g03420.1
Common NameLOC4349655, MIF1, Os11g0128300, OsJ_32792
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family ZF-HD
Protein Properties Length: 106aa    MW: 10860 Da    PI: 8.2955
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os11g03420.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer104.75.9e-333187259
       ZF-HD_dimer  2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59
                      + vrY+eC++NhAas+GghavDGC+Efm+s g+egtaaal CaACgCHR+FHRreve 
  LOC_Os11g03420.1 31 KVVRYRECQRNHAASIGGHAVDGCREFMAS-GAEGTAAALLCAACGCHRSFHRREVEA 87
                      579**************************9.999*********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257742.0E-123199IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047702.8E-313385IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.2E-273485IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.6983584IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005737Cellular Componentcytoplasm
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009089anatomyendosperm
PO:0007042developmental stagewhole plant fruit formation stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 106 aa     Download sequence    Send to blast
MGPQQDRSAA KPYANGSTAA AAAAGRKENN KVVRYRECQR NHAASIGGHA VDGCREFMAS  60
GAEGTAAALL CAACGCHRSF HRREVEAAAA ECDCSSDTSS GTGRR*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.167841e-180leaf| panicle| seed| stem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ2RB28
Functional Description ? help Back to Top
Source Description
UniProtInhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os11g03420.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs11g03420
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU4056101e-178CU405610.1 Oryza rufipogon (W1943) cDNA clone: ORW1943C006D05, full insert sequence.
GenBankCP0126191e-178CP012619.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 11 sequence.
GenBankAC1235251e-178AC123525.2 Oryza sativa (japonica cultivar-group) chromosome 11 clone OSJNBa0056E15, complete sequence.
GenBankAP0149671e-178AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
GenBankAK0637151e-178AK063715.1 Oryza sativa Japonica Group cDNA clone:001-120-C04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015615851.14e-70PREDICTED: mini zinc finger protein 1
SwissprotB8BIU85e-72MIF1_ORYSI; Mini zinc finger protein 1
SwissprotQ2RB285e-72MIF1_ORYSJ; Mini zinc finger protein 1
TrEMBLA0A0D3HHP15e-70A0A0D3HHP1_9ORYZ; Uncharacterized protein
TrEMBLI1QXA25e-70I1QXA2_ORYGL; Uncharacterized protein
STRINGBGIOSGA034718-PA1e-69(Oryza sativa Indica Group)
STRINGLOC_Os11g03420.11e-69(Oryza sativa Japonica Group)
STRINGORGLA11G0014400.11e-69(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9116237
MonocotsOGMP143134120
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28917.13e-19mini zinc finger 2
Publications ? help Back to Top
  1. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]
  2. Hu W,dePamphilis CW,Ma H
    Phylogenetic analysis of the plant-specific zinc finger-homeobox and mini zinc finger gene families.
    J Integr Plant Biol, 2008. 50(8): p. 1031-45
    [PMID:18713354]