PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os11g03420.1
Common NameLOC4349655, MIF1, Os11g0128300, OsJ_32792
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family ZF-HD
Protein Properties Length: 106aa    MW: 10860 Da    PI: 8.2955
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os11g03420.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer104.75.9e-333187259
       ZF-HD_dimer  2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59
                      + vrY+eC++NhAas+GghavDGC+Efm+s g+egtaaal CaACgCHR+FHRreve 
  LOC_Os11g03420.1 31 KVVRYRECQRNHAASIGGHAVDGCREFMAS-GAEGTAAALLCAACGCHRSFHRREVEA 87
                      579**************************9.999*********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257742.0E-123199IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047702.8E-313385IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.2E-273485IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.6983584IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005737Cellular Componentcytoplasm
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009089anatomyendosperm
PO:0007042developmental stagewhole plant fruit formation stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 106 aa     Download sequence    Send to blast
MGPQQDRSAA KPYANGSTAA AAAAGRKENN KVVRYRECQR NHAASIGGHA VDGCREFMAS  60
GAEGTAAALL CAACGCHRSF HRREVEAAAA ECDCSSDTSS GTGRR*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.167841e-180leaf| panicle| seed| stem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ2RB28
Functional Description ? help Back to Top
Source Description
UniProtInhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}.
UniProtInhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os11g03420.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs11g03420
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1235251e-178AC123525.2 Oryza sativa (japonica cultivar-group) chromosome 11 clone OSJNBa0056E15, complete sequence.
GenBankAK0637151e-178AK063715.1 Oryza sativa Japonica Group cDNA clone:001-120-C04, full insert sequence.
GenBankAP0149671e-178AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
GenBankCP0126191e-178CP012619.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 11 sequence.
GenBankCU4056101e-178CU405610.1 Oryza rufipogon (W1943) cDNA clone: ORW1943C006D05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015615851.19e-70mini zinc finger protein 1
SwissprotB8BIU88e-71MIF1_ORYSI; Mini zinc finger protein 1
SwissprotQ2RB288e-71MIF1_ORYSJ; Mini zinc finger protein 1
TrEMBLA0A0D3HHP12e-68A0A0D3HHP1_9ORYZ; Uncharacterized protein
TrEMBLI1QXA22e-68I1QXA2_ORYGL; Uncharacterized protein
STRINGOS11T0128300-013e-69(Oryza sativa)
STRINGORGLA11G0014400.13e-69(Oryza glaberrima)
STRINGOBART11G01670.13e-69(Oryza barthii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143134120
Representative plantOGRP9116237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28917.13e-19mini zinc finger 2
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]
  3. Hu W,dePamphilis CW,Ma H
    Phylogenetic analysis of the plant-specific zinc finger-homeobox and mini zinc finger gene families.
    J Integr Plant Biol, 2008. 50(8): p. 1031-45
    [PMID:18713354]