PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os11g03300.1
Common NameLOC4349648
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NAC
Protein Properties Length: 392aa    MW: 43336.3 Da    PI: 6.5683
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os11g03300.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.35.3e-52111381128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                       lppGfrFhPtdeel+v+yL +++++ k+++  +i+ev+iyk++PwdLp k+  +e+ewyfFs+rd+ky++g r+nra+ sgyWkatg+dk++l
  LOC_Os11g03300.1  11 LPPGFRFHPTDEELIVHYLMNQAASVKCPV-PIIAEVNIYKCNPWDLPGKALFGENEWYFFSPRDRKYPNGARPNRAAGSGYWKATGTDKSIL 102
                       79****************************.88***************8777899************************************** PP

               NAM  94 sk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                       s+ ++ ++g+kk Lvfykg+ pkg+ktdW+mheyrl
  LOC_Os11g03300.1 103 STpTSDNIGVKKALVFYKGKPPKGVKTDWIMHEYRL 138
                       9988899***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.97E-647172IPR003441NAC domain
PROSITE profilePS5100559.09911172IPR003441NAC domain
PfamPF023652.8E-2612138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MPSSGGAMPA LPPGFRFHPT DEELIVHYLM NQAASVKCPV PIIAEVNIYK CNPWDLPGKA  60
LFGENEWYFF SPRDRKYPNG ARPNRAAGSG YWKATGTDKS ILSTPTSDNI GVKKALVFYK  120
GKPPKGVKTD WIMHEYRLTG TSANSTTTTK QRRASSMTMR LDDWVLCRIH KKSNDFNSSD  180
QHDQEPEEST VEQLEDIHDN NSSEQPPAPA DMNNQQSDFQ PMTAMSMSKS CSLTDLLNTI  240
DCAALSQFLL DGSSDAIAEP PAPPSPLIYT TPHPNYQTLN YNINSNSSMP HAFESRLDHH  300
DGYVNNYNVN GLRRKRMMAC SATSFDDGSS SNDFVHAVVK KPQLLPSDSR GSGFGGGYCN  360
QQLSETATGF QFQNGNLLSH PFPLNNHLQM Q*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-731117815174Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.350200.0callus| flower| leaf| panicle| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329792810.0
Expression AtlasQ2RB40-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os11g03300.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs11g03300
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126190.0CP012619.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 11 sequence.
GenBankAC1235190.0AC123519.2 Oryza sativa (japonica cultivar-group) chromosome 11 clone OSJNBa0017B18, complete sequence.
GenBankAP0149670.0AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015615093.10.0PREDICTED: NAC transcription factor 29
SwissprotQ8H4S41e-86NAC10_ORYSJ; NAC transcription factor ONAC010
TrEMBLA0A0E0IXM60.0A0A0E0IXM6_ORYNI; Uncharacterized protein
TrEMBLQ2RB400.0Q2RB40_ORYSJ; NAC domain transcription factor, putative, expressed
STRINGLOC_Os11g03300.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MonocotsOGMP38033775
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.12e-82NAC-like, activated by AP3/PI
Publications ? help Back to Top
  1. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]