PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os11g03110.1
Common NameLOC4349638, Os11g0124300, OsJ_031458, SCR1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GRAS
Protein Properties Length: 652aa    MW: 69918.2 Da    PI: 6.3308
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os11g03110.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS410.51.5e-1252846442374
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykal.ppsetseknsseelaalklfsevsPilkf 93 
                        +lLl+cAe v++++l +a+++L ++ ela+p g+++qR+aayf+eA++arl++s+ +ly+ l +ps+++ + + +++aa+++f+ +sP++kf
  LOC_Os11g03110.1 284 LTLLLQCAESVNADNLDEAHRALLEIAELATPFGTSTQRVAAYFAEAMSARLVSSCLGLYAPLpNPSPAAARLHGRVAAAFQVFNGISPFVKF 376
                       579************************************************************777777777799999*************** PP

              GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrl 186
                       sh+taNqaI ea+e+eervHiiD+di+qGlQWp L++ LasRp+gpp++R+Tg+g+    s e+le+tg+rL++fA++lg+pfef + va++ 
  LOC_Os11g03110.1 377 SHFTANQAIQEAFEREERVHIIDLDIMQGLQWPGLFHILASRPGGPPRVRLTGLGA----SMEALEATGKRLSDFADTLGLPFEFCP-VADKA 464
                       ********************************************************....***************************.7**** PP

              GRAS 187 edleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres 279
                        +l++e+L v ++Ea+aV++    h+l+d ++s ++    +L+l+++l Pkvv++veq+++h s+sFl+rf+ea++yysalfdsl+a+++++s
  LOC_Os11g03110.1 465 GNLDPEKLGVTRREAVAVHWLR--HSLYDVTGSDSN----TLWLIQRLAPKVVTMVEQDLSH-SGSFLARFVEAIHYYSALFDSLDASYSEDS 550
                       ********************99..999999999999....**********************.899*************************** PP

              GRAS 280 eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSa 372
                        er++vE++ll+rei+nv+a  g +r+ + + +++Wre+l ++GF+  +l  +aa+qa lll +++sdgy++ ee+g+l lgWkd  L+++Sa
  LOC_Os11g03110.1 551 PERHVVEQQLLSREIRNVLAVGGPARTGDVK-FGSWREKLAQSGFRVSSLAGSAAAQAVLLLGMFPSDGYTLIEENGALKLGWKDLCLLTASA 642
                       *************************999987.************************************************************* PP

              GRAS 373 Wr 374
                       Wr
  LOC_Os11g03110.1 643 WR 644
                       *8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098561.986257624IPR005202Transcription factor GRAS
PfamPF035145.2E-123284644IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008356Biological Processasymmetric cell division
GO:0009630Biological Processgravitropism
GO:0009956Biological Processradial pattern formation
GO:0048366Biological Processleaf development
GO:0051457Biological Processmaintenance of protein location in nucleus
GO:0090610Biological Processbundle sheath cell fate specification
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 652 aa     Download sequence    Send to blast
MGSSSLLLFP SSSSSATHSS YSPSSSSHAI TSLLPPLPSD HHLLLYLDHQ EQHHLAAAMV  60
RKRPASDMDL PPPRRHVTGD LSDVTAAAAP SSASAQLPAL PTQLPAFHHT DMDLAAPAPP  120
PPQQQVAAGE GGPPSTAWVD GIIRDIIASS GAAVSVAQLI HNVREIIRPC NPDLASILEL  180
RLRSLLTSDP APPPPPPPSH PALLPPDATA PPPPPTSVAA LPPPPPPQPD KRRREPQCQE  240
QEPNQPQSPK PPTAEETAAA AAAAKERKEE QRRKQRDEEG LHLLTLLLQC AESVNADNLD  300
EAHRALLEIA ELATPFGTST QRVAAYFAEA MSARLVSSCL GLYAPLPNPS PAAARLHGRV  360
AAAFQVFNGI SPFVKFSHFT ANQAIQEAFE REERVHIIDL DIMQGLQWPG LFHILASRPG  420
GPPRVRLTGL GASMEALEAT GKRLSDFADT LGLPFEFCPV ADKAGNLDPE KLGVTRREAV  480
AVHWLRHSLY DVTGSDSNTL WLIQRLAPKV VTMVEQDLSH SGSFLARFVE AIHYYSALFD  540
SLDASYSEDS PERHVVEQQL LSREIRNVLA VGGPARTGDV KFGSWREKLA QSGFRVSSLA  600
GSAAAQAVLL LGMFPSDGYT LIEENGALKL GWKDLCLLTA SAWRPIQASG R*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-532836444375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.476230.0callus| panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329834900.0
Expression AtlasQ2RB59-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in the initial daughter cell before its asymmetric division and remains expressed in the endodermal cell layer after the division. {ECO:0000269|PubMed:17446396}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor required for quiescent center cells specification and maintenance of surrounding stem cells, and for the asymmetric cell division involved in radial pattern formation in roots. Essential for cell division but not differentiation of the ground tissue. Regulates the radial organization of the shoot axial organs. Restricts SHR movment and sequesters it into the nucleus of the endodermis (By similarity). {ECO:0000250, ECO:0000269|PubMed:17446396}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os11g03110.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDLOC_Os03g31880
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs11g03110
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0734670.0AK073467.1 Oryza sativa Japonica Group cDNA clone:J033044H21, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015615402.10.0PREDICTED: protein SCARECROW 1
SwissprotQ2RB590.0SCR1_ORYSJ; Protein SCARECROW 1
TrEMBLA0A0E0RD240.0A0A0E0RD24_ORYRU; Uncharacterized protein
STRINGLOC_Os11g03110.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP21831437
MonocotsOGMP137138122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54220.10.0GRAS family protein
Publications ? help Back to Top
  1. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]
  2. Cui H, et al.
    An evolutionarily conserved mechanism delimiting SHR movement defines a single layer of endodermis in plants.
    Science, 2007. 316(5823): p. 421-5
    [PMID:17446396]
  3. Wu S, et al.
    A plausible mechanism, based upon Short-Root movement, for regulating the number of cortex cell layers in roots.
    Proc. Natl. Acad. Sci. U.S.A., 2014. 111(45): p. 16184-9
    [PMID:25352666]