PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os11g01550.1
Common NameLOC4349560, LOC4351265, Os11g0106900, Os12g0106200, OsJ_34943, OSNPB_110106900, OSNPB_120106200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family LBD
Protein Properties Length: 157aa    MW: 17404.9 Da    PI: 6.931
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os11g01550.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260140.65e-4491081100
            DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkae 93 
                       +Ca+Ck+lrr+C+++Cv+apyfpae++++fa+vh++FGasnv+k+l ++p+ +r+da+sslvyeA+ar+rdPvyG+v+ i+ lq+q++ql+ +
  LOC_Os11g01550.1   9 PCASCKLLRRRCTSECVFAPYFPAEEAQRFAMVHRVFGASNVSKMLLDVPPPQRPDAVSSLVYEANARMRDPVYGCVAAISFLQNQVSQLQMQ 101
                       7******************************************************************************************** PP

            DUF260  94 lallkee 100
                       lal+++e
  LOC_Os11g01550.1 102 LALAHAE 108
                       **99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.688109IPR004883Lateral organ boundaries, LOB
PfamPF031953.9E-439106IPR004883Lateral organ boundaries, LOB
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009037anatomylemma
PO:0025281anatomypollen
PO:0001015developmental stageK second mitotic division stage
PO:0001047developmental stagelemma development stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 157 aa     Download sequence    Send to blast
MAGSGSGTPC ASCKLLRRRC TSECVFAPYF PAEEAQRFAM VHRVFGASNV SKMLLDVPPP  60
QRPDAVSSLV YEANARMRDP VYGCVAAISF LQNQVSQLQM QLALAHAETA ALQLQLQQQH  120
QDQDDHHHQQ CILENAAAHH QLMLQEAFLK KESMWT*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.560720.0callus| leaf| panicle
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ2QYU3
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os11g01550.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs11g01550
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBX0004970.0BX000497.1 Oryza sativa chromosome 11, . BAC OSJNBa0010K05 of library OSJNBa from chromosome 11 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
GenBankBX0004940.0BX000494.2 Oryza sativa chromosome 12, . BAC OSJNBa0052H10 of library OSJNBa from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
GenBankAP0149680.0AP014968.1 Oryza sativa Japonica Group DNA, chromosome 12, cultivar: Nipponbare, complete sequence.
GenBankAP0149670.0AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
GenBankAK2417610.0AK241761.1 Oryza sativa Japonica Group cDNA, clone: J065205C18, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015617628.11e-113PREDICTED: LOB domain-containing protein 12
RefseqXP_015618081.11e-113PREDICTED: LOB domain-containing protein 12
RefseqXP_015618082.11e-113PREDICTED: LOB domain-containing protein 12
RefseqXP_015618083.11e-113PREDICTED: LOB domain-containing protein 12
SwissprotQ8LBW31e-56LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA2ZAN01e-113A2ZAN0_ORYSI; Putative uncharacterized protein
TrEMBLQ2QYU31e-113Q2QYU3_ORYSJ; LOB domain protein 12, putative, expressed
STRINGBGIOSGA034653-PA1e-113(Oryza sativa Indica Group)
STRINGLOC_Os11g01550.11e-113(Oryza sativa Japonica Group)
STRINGLOC_Os12g01550.11e-113(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
MonocotsOGMP88238150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.15e-51LBD family protein
Publications ? help Back to Top
  1. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]