PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os11g01480.1
Common NameLOC4349554, OsJ_32654
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family G2-like
Protein Properties Length: 322aa    MW: 35054.6 Da    PI: 7.4797
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os11g01480.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like97.97.3e-3161114255
           G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       prlrWtpeLH +Fv+av++LGG+++AtPk +l+lm+v gL++ hvkSHLQ+YR+
  LOC_Os11g01480.1  61 PRLRWTPELHLSFVRAVDRLGGQDRATPKLVLQLMNVRGLSIGHVKSHLQMYRS 114
                       9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.8E-2957115IPR009057Homeodomain-like
PROSITE profilePS5129411.9257117IPR017930Myb domain
SuperFamilySSF466893.4E-1558115IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-2260116IPR006447Myb domain, plants
PfamPF002491.3E-862113IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MGSAGKEEEE EDGGGGAPAA AANNYGSSTT SSTTEEEGSG ESRRRTSSSS SVRPYVRSKN  60
PRLRWTPELH LSFVRAVDRL GGQDRATPKL VLQLMNVRGL SIGHVKSHLQ MYRSKKIDES  120
GQVIGGESWR SDDHLQMQGG GHGGQAYNLG HLSLPALHHR SITAGSGTIF QSRFGNSWSP  180
WRCHGSYWLP AGHHLLVGSK PYYPPAAEAE APFRRSSARY VARANTSNHP DFVQGSSSSP  240
DDNIMNHQRP VLKEMICSEG SNHQEGPLNL DLSLDICPRG EKRKRECSWR KQEEDHDHAT  300
VAIGADQEAE SCATGLSLSL F*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.184480.0callus| leaf| panicle| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329925060.0
Expression AtlasQ2RBM7-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os11g01480.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs11g01480
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2411710.0AK241171.1 Oryza sativa Japonica Group cDNA, clone: J065117O05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015617115.10.0PREDICTED: probable transcription factor RL9
TrEMBLA0A0E0IWY80.0A0A0E0IWY8_ORYNI; Uncharacterized protein
TrEMBLA0A0E0R3440.0A0A0E0R344_ORYRU; Uncharacterized protein
TrEMBLA2ZH980.0A2ZH98_ORYSI; Putative uncharacterized protein
TrEMBLQ2RBM70.0Q2RBM7_ORYSJ; Myb-like DNA-binding domain, SHAQKYF class family protein, expressed
STRINGBGIOSGA036796-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os11g01480.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP28515123
MonocotsOGMP44083671
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.14e-38G2-like family protein
Publications ? help Back to Top
  1. Rice Chromosomes 11 and 12 Sequencing Consortia
    The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
    BMC Biol., 2005. 3: p. 20
    [PMID:16188032]