PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os11g01130.2
Common NameLOC107275468, Os11g0102100, Os12g0101600, OSNPB_110102100, OSNPB_120101600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family WOX
Protein Properties Length: 235aa    MW: 25921.2 Da    PI: 8.8891
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os11g01130.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.66.9e-21666257
                      T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
          Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                      ++R+++t+eql +Lee++++  r+p+a+e+++++++l    +++ ++V++WFqN++a+e++
  LOC_Os11g01130.2  6 STRWCPTPEQLMILEEMYRSgVRTPNAAEIQQITAHLayygRIEGKNVFYWFQNHKARERQ 66
                      58*****************99**************************************97 PP

2Wus_type_Homeobox121.34e-39567264
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
                       ++tRW+PtpeQ++iLee+y+sG+rtPn++eiq+ita+L+ yG+ie+kNVfyWFQN+kaRerq+
   LOC_Os11g01130.2  5 PSTRWCPTPEQLMILEEMYRSGVRTPNAAEIQQITAHLAYYGRIEGKNVFYWFQNHKARERQR 67
                       689***********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.463267IPR001356Homeobox domain
SMARTSM003896.8E-6471IPR001356Homeobox domain
CDDcd000862.77E-4560No hitNo description
PfamPF000461.5E-18666IPR001356Homeobox domain
SuperFamilySSF466891.15E-11767IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.7E-8866IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MPQTPSTRWC PTPEQLMILE EMYRSGVRTP NAAEIQQITA HLAYYGRIEG KNVFYWFQNH  60
KARERQRLRR RLCARHQQQP SPPSSTVPPA PTAAAAGAVV QVHPAVMQLH HHHHHHHPYA  120
AAAAAQSHHL QQQQQQQAEW PAAVDYCSTA SASASATAAD MAIPPCCRPL KTLELFPTKS  180
TSGGLKEDCC SSSKPWARSV VESLGGRERS SLAVVDSGGD MDGIERRRRE LGER*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224229ERRRRE
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasA0A0P0Y5V3
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os11g01130.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs11g01130
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4902430.0AM490243.1 Oryza sativa mRNA for putative narrow sheath protein (ns gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015619605.11e-174PREDICTED: WUSCHEL-related homeobox 3 isoform X1
SwissprotA2ZH471e-144WOX3_ORYSI; WUSCHEL-related homeobox 3
SwissprotQ33DK11e-144WOX3_ORYSJ; WUSCHEL-related homeobox 3
TrEMBLA0A0P0Y5V31e-174A0A0P0Y5V3_ORYSJ; Os11g0102100 protein
TrEMBLA8Y7W41e-174A8Y7W4_ORYSA; Putative narrow sheath protein
STRINGLOC_Os11g01130.21e-173(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP55801121
MonocotsOGMP21773897
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28610.18e-35WOX family protein