PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os10g42490.2
Common NameGL2-3, LOC4349488, Os10g0575600, OsJ_031281, OSJNBa0027L23.2, ROC3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family HD-ZIP
Protein Properties Length: 883aa    MW: 94667.2 Da    PI: 5.8927
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os10g42490.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.61.3e-20135190156
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       +++ +++t++q++++e+lF+++++p+ ++r +L+++lgL+ rqVk+WFqNrR+++k
  LOC_Os10g42490.2 135 KKRYHRHTAHQIQQMEALFKECPHPDDKQRLKLSQELGLKPRQVKFWFQNRRTQMK 190
                       688999***********************************************998 PP

2START129.93e-413505812206
                       HHHHHHHHHHHHHHHC-TT-EEEE.......EXCCTTEEEEEEESSS.................SCEEEEEEEECCSCHHHHHHHHHCCCGGC CS
             START   2 laeeaaqelvkkalaeepgWvkss.......esengdevlqkfeeskv................dsgealrasgvvdmvlallveellddkeq 71 
                       la +aa++l ++  a+ep+Wv+ +       e           e ++                  + e  r+ +vv+m++ +lv  +ld + +
  LOC_Os10g42490.2 350 LAATAADQLARMCRAGEPLWVRQRgaevmavE-----------EHARMfswpvdgakqgdggavARAEGTRDNAVVIMNSINLVDAFLDAN-K 430
                       678999******************66554333...........3333344444445567778888888888999*****************.* PP

                       T-TT-S....EEEEEEEECTT........EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE..TTS-EEEEEEEEE-TTS--...-TTSEE-EES CS
             START  72 Wdetla....kaetlevissg........galqlmvaelqalsplvp.RdfvfvRyirq.lgagdwvivdvSvdseqkppe..sssvvRaell 148
                       W e ++    ka t++ i+ g        g+l lm+ae q+lsplv+ R++vf Ry+     +g+w+ivd   +  ++     ++svvR++++
  LOC_Os10g42490.2 431 WMELFPsivcKARTIQIINHGaasghlgsGTLLLMQAEVQFLSPLVAaREVVFFRYCVHnADEGSWAIVDFPAEGFEE--GllQASVVRCRRR 521
                       ***********************************************************9999*******55555555..356********** PP

                       SEEEEEEEECTCEEEEEEEE-EE--SSXX..HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
             START 149 pSgiliepksnghskvtwvehvdlkgrlp..hwllrslvksglaegaktwvatlqrqcek 206
                       pSg++i++++ng+s+v+wveh+++ g     + ++r  v sg+a+ga +w++ lqrqce+
  LOC_Os10g42490.2 522 PSGCIIQDMPNGYSRVVWVEHMEMVGEEKplQPVFRDYVASGAAFGATRWLSILQRQCER 581
                       ***********************98765449***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.0E-19119193IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.5E-22122186IPR009057Homeodomain-like
PROSITE profilePS5007117.167132192IPR001356Homeobox domain
SMARTSM003893.4E-19133196IPR001356Homeobox domain
PfamPF000463.7E-18135190IPR001356Homeobox domain
CDDcd000866.99E-19135193No hitNo description
PROSITE patternPS000270167190IPR017970Homeobox, conserved site
PROSITE profilePS5084844.182340584IPR002913START domain
SuperFamilySSF559611.79E-28343583No hitNo description
CDDcd088751.12E-100344580No hitNo description
SMARTSM002349.3E-23349581IPR002913START domain
PfamPF018522.1E-33350581IPR002913START domain
Gene3DG3DSA:3.30.530.202.1E-4463547IPR023393START-like domain
SuperFamilySSF559611.92E-15606778No hitNo description
SuperFamilySSF559611.92E-15824863No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048497Biological Processmaintenance of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009049anatomyinflorescence
PO:0001083developmental stageinflorescence development stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 883 aa     Download sequence    Send to blast
MRRMFGDCQV LSSMAAMAGA ASSADALFAS PLIPNPALAG FMSSSAAMPF HHFSNAAATL  60
IPKEEGLMGG LHVAKDEGMD LEMDMELSGG SGSAHLDGLL SFADVDDDHK PQHSGHDQPP  120
DAAQPSGAAG GNAKKKRYHR HTAHQIQQME ALFKECPHPD DKQRLKLSQE LGLKPRQVKF  180
WFQNRRTQMK AQQDRADNVI LRAENENLKS DNFRLQAAIR NVVCPNCGHA AVLADMSYEE  240
QQLRIENARL KDELDRLACI ATRYGGGGGR QPVLSTSALS CISAPPPVLM PPLDLDMNVY  300
SRHFAEQAPV MGCGDLIPPP VVPQHDGAAA YMGAMMAPVQ EQDKQLVVDL AATAADQLAR  360
MCRAGEPLWV RQRGAEVMAV EEHARMFSWP VDGAKQGDGG AVARAEGTRD NAVVIMNSIN  420
LVDAFLDANK WMELFPSIVC KARTIQIINH GAASGHLGSG TLLLMQAEVQ FLSPLVAARE  480
VVFFRYCVHN ADEGSWAIVD FPAEGFEEGL LQASVVRCRR RPSGCIIQDM PNGYSRVVWV  540
EHMEMVGEEK PLQPVFRDYV ASGAAFGATR WLSILQRQCE RLASELARNI ADLGVIRTPE  600
ARTNMMKLSQ RMITTFCANI SASGTQSWTA LSDSTQDTIR VTTRKNTEPG QPSGVILTAV  660
STSWLPFTHQ QVFELLADEQ QRCQLEILSN GGSLHEVAHI ANGSHPRNCI SLLRINAASN  720
SSQNVELLLQ ESSTHPDGGS LVVFATVDVD AIQVTMSGED PSYIPLLPLG FAIFPATSPS  780
PAAAPTISSS TTTTTGNGNG ETSSTPPRNS SSNNNNADEL LPPNGCLLTV GMQVLASAVP  840
SAKLNLSSVT AINSHVCNAI HQITAALKSS AGGAGGEPAS DQ*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.185490.0callus| flower| panicle| stem| vegetative meristem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329819620.0
Expression AtlasQ336P2-
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os10g42490.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs10g42490
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB1016460.0AB101646.1 Oryza sativa Japonica Group Roc3 mRNA for GL2-type homeodomain protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015613461.10.0PREDICTED: homeobox-leucine zipper protein ROC3
SwissprotQ336P20.0ROC3_ORYSJ; Homeobox-leucine zipper protein ROC3
TrEMBLA0A0E0R2V40.0A0A0E0R2V4_ORYRU; Uncharacterized protein
STRINGLOC_Os10g42490.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G46880.10.0homeobox-7