PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os10g41260.1
Common NameLOC4349391, Os10g0562100, OsJ_32468, OSJNBb0089A17.5, OSNPB_100562100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB_related
Protein Properties Length: 266aa    MW: 29271 Da    PI: 7.0659
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os10g41260.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.61.9e-15100144347
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       +WT+eE+++++++ +qlG+g+W+ I++ + + Rt+ q+ s+ qky
  LOC_Os10g41260.1 100 PWTEEEHKKFLEGLRQLGKGDWRGISKNFVTSRTATQVASHAQKY 144
                       8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.87893149IPR017930Myb domain
SuperFamilySSF466894.31E-1894149IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-1896148IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.605.3E-1297143IPR009057Homeodomain-like
SMARTSM007179.3E-1297147IPR001005SANT/Myb domain
PfamPF002497.5E-13100144IPR001005SANT/Myb domain
CDDcd001671.28E-10100145No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MEQHEEAAER KPSPPVIFRL FGVEVRGGGG GVDEEEYEEE EVEGGLFIKK SSSMPNLTSI  60
DPLPVPADGG KRRASDDSEL ASGQQKRRRR KVQERKKGVP WTEEEHKKFL EGLRQLGKGD  120
WRGISKNFVT SRTATQVASH AQKYFLRQTN PGKKKRRASL FDVVAECSDD QLPSPQSVGT  180
KPPTQDIIHT DRGDVPILSY PVARGFRGDS VQVDELTEYV KRLKAAEDMS LSMISGLEMA  240
SSSISSLELS IAPPHCAIEA AIKVL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17090KRRASDDSELASGQQKRRRRK
28590KRRRRK
38596KRRRRKVQERKK
48696RRRRKVQERKK
5152156KKKRR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.1008100.0callus| leaf| panicle| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1567656010.0
Expression AtlasQ7XC51-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os10g41260.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs10g41260
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2889860.0AK288986.1 Oryza sativa Japonica Group cDNA, clone: J090086G02, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015612867.10.0PREDICTED: transcription factor MYB1R1
TrEMBLA0A0E0R2I40.0A0A0E0R2I4_ORYRU; Uncharacterized protein
TrEMBLB8BI930.0B8BI93_ORYSI; Uncharacterized protein
TrEMBLQ7XC510.0Q7XC51_ORYSJ; MCB1 protein, putative, expressed
STRINGBGIOSGA031397-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os10g41260.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1453244
MonocotsOGMP104643043
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.13e-31MYB_related family protein
Publications ? help Back to Top
  1. Lu CA,Ho TH,Ho SL,Yu SM
    Three novel MYB proteins with one DNA binding repeat mediate sugar and hormone regulation of alpha-amylase gene expression.
    Plant Cell, 2002. 14(8): p. 1963-80
    [PMID:12172034]