PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os10g41200.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB_related
Protein Properties Length: 236aa    MW: 26201.5 Da    PI: 5.3465
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os10g41200.3genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.67e-141256347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                      +WT+eE+ +++ + ++lG+g+W+ I+r +   Rt+ q+ s+ qky
  LOC_Os10g41200.3 12 PWTEEEHRRFLLGLQKLGKGDWRGISRNFVVSRTPTQVASHAQKY 56
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.912561IPR017930Myb domain
SuperFamilySSF466891.2E-16962IPR009057Homeodomain-like
SMARTSM007174.7E-10959IPR001005SANT/Myb domain
TIGRFAMsTIGR015576.2E-191160IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.5E-111155IPR009057Homeodomain-like
CDDcd001672.24E-91257No hitNo description
PfamPF002493.0E-111256IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000122Biological Processnegative regulation of transcription from RNA polymerase II promoter
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0030307Biological Processpositive regulation of cell growth
GO:0046686Biological Processresponse to cadmium ion
GO:0048366Biological Processleaf development
GO:2000469Biological Processnegative regulation of peroxidase activity
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    Send to blast
MFLIKMTLTG VPWTEEEHRR FLLGLQKLGK GDWRGISRNF VVSRTPTQVA SHAQKYFIRQ  60
SNMTRRKRRS SLFDMVPDES MDLPPLPGGQ EPETQVLNQP ALPPPREEEE VDSMESDTSA  120
VAESSSASAI MPDNLQSTYP VIVPAYFSPF LQFSVPFWQN QKDEDGPVQE THEIVKPVPV  180
HSKSPINVDE LVGMSKLSIG ESNQETVSTS LSLNLVGGQN RQSAFHANPP TRAQA*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.487211e-174callus| flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329907671e-174
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00551DAPTransfer from AT5G47390Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os10g41200.3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs10g41200
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0597160.0AK059716.1 Oryza sativa Japonica Group cDNA clone:001-032-G03, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015614288.11e-167PREDICTED: transcription factor MYB1R1
TrEMBLA0A0E0BDS91e-174A0A0E0BDS9_9ORYZ; Uncharacterized protein
STRINGLOC_Os10g41200.11e-166(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.11e-70MYB_related family protein