PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os10g40810.1
Common NameLOC4349356, OSJNBa0010C11.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GATA
Protein Properties Length: 388aa    MW: 39620.8 Da    PI: 7.77
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os10g40810.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.76.5e-18278313136
              GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkglk 36 
                       C++C + kTp+WR gp g+ktLCnaCG+++++ +l+
  LOC_Os10g40810.1 278 CTHCASEKTPQWRTGPLGPKTLCNACGVRFKSGRLM 313
                       ********************************9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004012.3E-16272322IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.253272308IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.09E-13276336No hitNo description
Gene3DG3DSA:3.30.50.102.5E-13276310IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.34E-13277324No hitNo description
PfamPF003201.4E-15278313IPR000679Zinc finger, GATA-type
PROSITE patternPS003440278303IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009416Biological Processresponse to light stimulus
GO:0030154Biological Processcell differentiation
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 388 aa     Download sequence    Send to blast
MASEWEMAMG VDLGMGMSTY HNASGGIAAA PMMGHHGGGG GGGGYSAAHH HHHHYYGMPH  60
QAAMGDAMRV DDLLDLSNTP GAHDFFPASA AAAAAGDHGH HHHHHIGGMG EPSGATPSAT  120
SSDHQTSMLS FADDFYIPTE DAAELEWLSK FVDDSYSDMP NYQSSAHAAM AAAAASAANN  180
GGGSSAGQDS CLTAAPGRGA RSKRSRATAA AAAAWHSLVP RPPSQSSPSS SCSSSDFPSS  240
NKPSGTARPN GSGGGSRGKK SPGPAGAEVG MEAGVRRCTH CASEKTPQWR TGPLGPKTLC  300
NACGVRFKSG RLMPEYRPAA SPTFVLTQHS NSHRKVMELR RQKELLIIRG SHRDAAAAAA  360
AAAAAAAAGS AAATGRPELM FRDYGVC*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.466250.0leaf| panicle| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1160116570.0
Expression AtlasQ94LQ6-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os10g40810.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs10g40810
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126180.0CP012618.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 10 sequence.
GenBankAC0693000.0AC069300.7 Oryza sativa chromosome 10 BAC OSJNBa0010C11 genomic sequence, complete sequence.
GenBankAP0149660.0AP014966.1 Oryza sativa Japonica Group DNA, chromosome 10, cultivar: Nipponbare, complete sequence.
GenBankAK2422920.0AK242292.1 Oryza sativa Japonica Group cDNA, clone: J075191F19, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015613303.10.0PREDICTED: GATA transcription factor 2
SwissprotO497413e-62GATA2_ARATH; GATA transcription factor 2
TrEMBLA0A0E0IWD60.0A0A0E0IWD6_ORYNI; Uncharacterized protein
TrEMBLA0A0E0R2D30.0A0A0E0R2D3_ORYRU; Uncharacterized protein
TrEMBLA2ZA510.0A2ZA51_ORYSI; Uncharacterized protein
TrEMBLQ94LQ60.0Q94LQ6_ORYSJ; GATA zinc finger family protein, expressed
STRINGBGIOSGA033429-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os10g40810.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6817287
MonocotsOGMP46212955
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45050.12e-45GATA transcription factor 2