PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os10g40390.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GRAS
Protein Properties Length: 684aa    MW: 74280.4 Da    PI: 8.7412
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os10g40390.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS257.93.7e-79363692346
              GRAS   2 velLlecAeavssgdlelaqalLarlsel...aspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                       ve+L e+A+  ++gd+  a+++Larl+ +   a  +g+p+ R a+yf+eAL+ +l+     + +a +ps++++++++ +l a+k+fsevsP+l
  LOC_Os10g40390.1  36 VEQLAEAAKLAEAGDAFGAREILARLNYRlpaAPTAGTPLLRSAFYFKEALRLTLSP----TGDAPAPSASTPYDVVVKLGAYKAFSEVSPVL 124
                       789*************************999555566*******************9....999999************************** PP

              GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvak 184
                       +f+hlt+ qa+l+++ g+ ++H++Dfdi++G QW++L+q+La+  ++++ l++T+++sp+s++  el+ ++e+L+ fA+elgv f+f+v+   
  LOC_Os10g40390.1 125 QFAHLTCVQAVLDELGGAGCIHVLDFDIGMGEQWASLMQELAQ-LRPAAALKVTALVSPASHHPLELQLIHENLSGFAAELGVFFHFTVF--- 213
                       ******************************************7.46788****************************************9... PP

              GRAS 185 rledleleeLrvkp..gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleakl 275
                       ++++l++ eL  +   g+a+aV+l +   +          ++++vL+lvk+l +kvvv v++ +d+++ +F+++++++++  ++l++s++a  
  LOC_Os10g40390.1 214 NIDTLDPAELLANAtaGDAVAVHLPVGPAHAA--------ATPAVLRLVKRLGAKVVVSVDRGCDRSDLPFAAHLFHSFHSAVYLLESIDAV- 297
                       9999*99999666667**********999997........5678*********************************************998. PP

              GRAS 276 preseerikvErellgreivnvvacegae.rrerhetlekWrerleeaGFkpvplsekaakqaklllrkvks 346
                       +++ ++++k+Er l++++i+++v +++++ + +++     Wr+++ +aGF pv+ +++a++qa++ll+k +s
  LOC_Os10g40390.1 298 GTDPDTASKIERYLIHPAIEQCVVASHRAaSAMDKAPPPPWRAAFAAAGFAPVQATTFAESQAESLLSKLGS 369
                       7888*****************9888777658999999*******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098538.6759377IPR005202Transcription factor GRAS
PfamPF035141.3E-7636369IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 684 aa     Download sequence    Send to blast
MAAAPAPKLP PFPAGGFVPA LKPKAEAAND EAAAAVEQLA EAAKLAEAGD AFGAREILAR  60
LNYRLPAAPT AGTPLLRSAF YFKEALRLTL SPTGDAPAPS ASTPYDVVVK LGAYKAFSEV  120
SPVLQFAHLT CVQAVLDELG GAGCIHVLDF DIGMGEQWAS LMQELAQLRP AAALKVTALV  180
SPASHHPLEL QLIHENLSGF AAELGVFFHF TVFNIDTLDP AELLANATAG DAVAVHLPVG  240
PAHAAATPAV LRLVKRLGAK VVVSVDRGCD RSDLPFAAHL FHSFHSAVYL LESIDAVGTD  300
PDTASKIERY LIHPAIEQCV VASHRAASAM DKAPPPPWRA AFAAAGFAPV QATTFAESQA  360
ESLLSKLGSA SASACADAEC HVAMVLYCPL IKERERKRWN VHLVIVLVEL NTPQAEKNQR  420
EVGGYGGEKN KILSEYNLLP LPVLEMQRKG GNHGVKRPCF TEMAAKHLRV RTGTSRTAAA  480
TLDGYTTLTW DSAPEWPWHR MHKPDRLRWA HWRVTGEPQC AAGAVAIGQA SGHTGVRDTA  540
GANWQETCIV VTEMDVKLAD KFRKKWYHSS KLQKRRCTVG LIKQDLKVQN QGGESEASRH  600
KGLQISFRQV QISLRKPNRK CKHSGQTVKL INENCYYLST KRNNLKIKEV NYICYIYAEE  660
LHPLKVMFRN TQAKICQIDV QKS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-226736432340GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.468780.0callus| panicle| root| vegetative meristem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329914480.0
Expression AtlasQ7XCD7-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os10g40390.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs10g40390
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0267580.0AC026758.8 Oryza sativa chromosome 10 BAC OSJNBa0015J15 genomic sequence, complete sequence.
GenBankAP0149660.0AP014966.1 Oryza sativa Japonica Group DNA, chromosome 10, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004983723.10.0PREDICTED: scarecrow-like protein 6 isoform X1
TrEMBLQ7XCD70.0Q7XCD7_ORYSJ; GRAS family transcription factor containing protein, expressed
STRINGLOC_Os10g40390.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP17501242
MonocotsOGMP67232954
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.15e-63GRAS family protein