PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os10g39720.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family HB-other
Protein Properties Length: 125aa    MW: 13521.3 Da    PI: 11.8489
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os10g39720.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox34.33.9e-1180124246
                       T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHH CS
          Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkv 46 
                       rk+ +++k+q  +Le+ F+k+++++ ++++ LA++l+L+ rqV v
  LOC_Os10g39720.1  80 RKKLRLSKDQAAVLEDTFNKHNTLNPKQKAALARQLNLKPRQVEV 124
                       788899*************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.1E-1268124IPR009057Homeodomain-like
SuperFamilySSF466891.28E-969124IPR009057Homeodomain-like
PROSITE profilePS500719.97776124IPR001356Homeobox domain
PfamPF000461.6E-880124IPR001356Homeobox domain
CDDcd000865.31E-880124No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 125 aa     Download sequence    Send to blast
MSSSLFLLPP LFLSLFSPLR LAAGSTGWGG SGRGQERRRE LKRRRRRHTL SSLSGKRGAP  60
SAAAAAVGGS DDEDSDDGSR KKLRLSKDQA AVLEDTFNKH NTLNPKQKAA LARQLNLKPR  120
QVEV*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14146KRRRRR
27884SRKKLRL
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.230434e-93root
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ7XCK2
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os10g39720.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs10g39720
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0516338e-91AC051633.7 Oryza sativa chromosome 10 BAC OSJNBb0015I11 genomic sequence, complete sequence.
GenBankAP0149668e-91AP014966.1 Oryza sativa Japonica Group DNA, chromosome 10, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002467488.13e-28hypothetical protein SORBIDRAFT_01g029000
SwissprotQ7XC541e-25HOX1_ORYSJ; Homeobox-leucine zipper protein HOX1
SwissprotQ406911e-25HOX1_ORYSI; Homeobox-leucine zipper protein HOX1
TrEMBLQ7XCK23e-83Q7XCK2_ORYSJ; Homeobox domain containing protein
STRINGLOC_Os10g39720.19e-83(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.14e-19homeobox from Arabidopsis thaliana