PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os10g39550.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family G2-like
Protein Properties Length: 330aa    MW: 36131.5 Da    PI: 8.3524
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os10g39550.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.41.2e-311972255
           G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                      prlrWtp+LH++Fv+a+++LGG++kAtPk++l+lm+v gLt++hvkSHLQ+YR 
  LOC_Os10g39550.1 19 PRLRWTPDLHHCFVHAIHKLGGQHKATPKRVLQLMGVGGLTISHVKSHLQMYRN 72
                      8****************************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.8941575IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-301574IPR009057Homeodomain-like
SuperFamilySSF466891.79E-151773IPR009057Homeodomain-like
TIGRFAMsTIGR015572.8E-241972IPR006447Myb domain, plants
PfamPF002496.0E-102071IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MVRRERIEGV RQYNRSKVPR LRWTPDLHHC FVHAIHKLGG QHKATPKRVL QLMGVGGLTI  60
SHVKSHLQMY RNMRNDDLGM QGIQQMDDQE QTFAGGMQIW TDMQLQDHHH ECNGPYCRCH  120
SSSKHAKGSL LLLHHHHQQQ QLQRPNEMET RRAEASTQTG FLRSQGICER DVSSGLPVPA  180
AYYSYYTPMA HGAPPAAADG AGHDDPPRLL GLVVMATTTR RGSREEHKAT PPPENGAIRH  240
GRKARRTTAA AEEEERDGDG DELSLSLTLD SGLSCRSSGG AGAYCCSEGS SSNWLISSPS  300
STTSLVAGGC SRRSTPAMLS SVVSLDLSL*
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ7XCL9
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os10g39550.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs10g39550
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0731661e-177AC073166.7 Oryza sativa chromosome 10 BAC OSJNBb0064P21 genomic sequence, complete sequence.
GenBankAC0516331e-177AC051633.7 Oryza sativa chromosome 10 BAC OSJNBb0015I11 genomic sequence, complete sequence.
GenBankAP0149661e-177AP014966.1 Oryza sativa Japonica Group DNA, chromosome 10, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003572016.31e-62PREDICTED: uncharacterized protein LOC100832345
TrEMBLQ7XCL90.0Q7XCL9_ORYSJ; Myb-like DNA-binding domain, SHAQKYF class family protein
STRINGLOC_Os10g39550.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP28515123
MonocotsOGMP76102950
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02060.12e-29G2-like family protein