PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os10g39030.1
Common NameLOC4349233, Os10g0534900, OSJNBa0053C23.7, OSNPB_100534900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family TALE
Protein Properties Length: 587aa    MW: 62859 Da    PI: 6.9728
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os10g39030.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.98.3e-093443811954
                       HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
          Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                       Fe   ++yps  ++  LA+++gL+ +qV +WF N R +
  LOC_Os10g39030.1 344 FEHflHPYPSDVDKHILARQTGLSRSQVANWFINARVR 381
                       664459******************************88 PP

2BELL94.31.1e-30207277272
              BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                        +elq+ k kL ++leeVd+rY++y+eq++++++sFeavag  +a++Yt+lA+++iSrhFr+L+d ++ q+
  LOC_Os10g39030.1 207 AAELQRLKGKLYTMLEEVDRRYRRYCEQMRALAASFEAVAGERAAASYTRLASRTISRHFRSLRDGVVAQL 277
                       5799****************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005743.9E-45140275IPR006563POX domain
PfamPF075261.5E-42146273IPR006563POX domain
PROSITE profilePS5007112.001322385IPR001356Homeobox domain
SMARTSM003895.2E-9325389IPR001356Homeobox domain
CDDcd000865.41E-12325386No hitNo description
SuperFamilySSF466893.85E-17326392IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-27328391IPR009057Homeodomain-like
PfamPF059202.2E-17342381IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 587 aa     Download sequence    Send to blast
MAHDPSLGYA DYFAAEVDGT GATELYGLQQ HQQGVGVAEM FGVRGLMPAA HAHEQSKGVG  60
ALVVGGGGVD DGGATTLPTV HFGGLGELHH HQHRQSQAPL SLSLHRPEAA ATSLLMQQQQ  120
QHLHHQPSPP AGAASTWQLQ QGAWHLRGSR FLLPTQQLLQ EFCSLPVKST TSPSSASKAT  180
KPPQEEAASG GGSSSWTAPT QIQSMDAAEL QRLKGKLYTM LEEVDRRYRR YCEQMRALAA  240
SFEAVAGERA AASYTRLASR TISRHFRSLR DGVVAQLQAV RKQLGEKDTA VPGMTKGETP  300
RLRVLDQCLR QHKAYQAGML ESHPWRPQRG LPERAVSILR AWLFEHFLHP YPSDVDKHIL  360
ARQTGLSRSQ VANWFINARV RLWKPMVEEM YAEEMKDEEG SGQSTQASNP QNPNPSSYTS  420
EVRGGGGGGE DRGEQKPSRA QLLHDAGSLA SVVSIGHGGA GRTMVDHHHH QSLNFGTMDQ  480
LDFDAYEAAG GGQGFGAGGG VSLTLGLQQQ HADPHDGVNV AFAAAAAPPN SSGVAAEYLF  540
MGGGEHQQQL PQTAQFGAVM EGDAASHYRG LSATAAGFHL LHDLAG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A2e-16331388158Homeobox protein Meis1
4xrs_B2e-16331388158Homeobox protein Meis1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.173010.0flower| leaf| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329780470.0
Expression AtlasQ8LN25-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os10g39030.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs10g39030
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0680290.0AK068029.1 Oryza sativa Japonica Group cDNA clone:J013134A07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015614125.10.0PREDICTED: BEL1-like homeodomain protein 4
TrEMBLQ8LN250.0Q8LN25_ORYSJ; Associated with HOX family protein, expressed
STRINGLOC_Os10g39030.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP13316172
MonocotsOGMP38143764
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36870.28e-83BEL1-like homeodomain 2