PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os10g38834.1
Common NameLOC4349213, Os10g0532000, OSNPB_100532000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NAC
Protein Properties Length: 342aa    MW: 37539.7 Da    PI: 4.8801
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os10g38834.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.81e-5381371129
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                       +ppGfrFhPtdeelv +yL+kkv+++k++l +vi++vd+y++ePwdL++  ++   e++ewyfFs +d+ky+tg+r+nrat +g+Wkatg+dk
  LOC_Os10g38834.1   8 VPPGFRFHPTDEELVGYYLRKKVASQKIDL-DVIRDVDLYRIEPWDLQEhcRIGYeEQSEWYFFSYKDRKYPTGTRTNRATMTGFWKATGRDK 99 
                       69****************************.9***************953533332566********************************** PP

               NAM  91 evlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                       +v + +++l+g++ktLvfykgrap+g+ktdW++heyrle
  LOC_Os10g38834.1 100 AVRE-RSRLIGMRKTLVFYKGRAPNGHKTDWIVHEYRLE 137
                       ***9.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-584157IPR003441NAC domain
PROSITE profilePS5100558.5948157IPR003441NAC domain
PfamPF023656.3E-279136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009047anatomystem
PO:0007010developmental stagewhole plant fruit ripening stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MVIMESCVPP GFRFHPTDEE LVGYYLRKKV ASQKIDLDVI RDVDLYRIEP WDLQEHCRIG  60
YEEQSEWYFF SYKDRKYPTG TRTNRATMTG FWKATGRDKA VRERSRLIGM RKTLVFYKGR  120
APNGHKTDWI VHEYRLESDE NAPPQEEGWV VCRAFKKRTM QPPRSSIGAW EASYSYHDPA  180
VFVGGGEHFK QEAAAELDGV AAAAGANAFL RYSTRLAELP QLESPPLPSQ GSQAASAVVD  240
GEEDNADSSR RPGGGGGAAA AVTTDWRAFD KFVASQLSPE EQHTCRATDD DDMAALLLLD  300
GGGQEDDAGR WLGSAGLLSA VAADATTDCG LGTSCVPGDI N*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-50515912170Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.611490.0callus| panicle| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329915220.0
Expression AtlasQ109C3-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os10g38834.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs10g38834
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN6340730.0JN634073.1 Oryza sativa Japonica Group secondary wall NAC transcription factor 4 mRNA, complete cds.
GenBankAK1063130.0AK106313.1 Oryza sativa Japonica Group cDNA clone:002-101-D07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015613865.10.0PREDICTED: NAC domain-containing protein 105
SwissprotO655081e-119NAC76_ARATH; NAC domain-containing protein 76
TrEMBLQ109C30.0Q109C3_ORYSJ; No apical meristem, putative, expressed
STRINGLOC_Os10g38834.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MonocotsOGMP36253768
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18060.11e-107vascular related NAC-domain protein 1
Publications ? help Back to Top
  1. Zhong R, et al.
    Transcriptional activation of secondary wall biosynthesis by rice and maize NAC and MYB transcription factors.
    Plant Cell Physiol., 2011. 52(10): p. 1856-71
    [PMID:21908441]